G6PC Antibody - BSA Free

Immunohistochemistry-Paraffin: G6PC Antibody [NBP2-31916] - Staining of human testis shows no cytoplasmic positivity in cells in seminiferous ducts as expected.

Immunohistochemistry-Paraffin: G6PC Antibody [NBP2-31916] - Staining of human duodenum shows moderate cytoplasmic positivity in glandular cells.

Immunohistochemistry-Paraffin: G6PC Antibody [NBP2-31916] - Staining of human liver shows moderate cytoplasmic positivity in hepatocytes.

• Reactivity: Hu, Mu
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

G6PC Antibody - BSA Free Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: MEEGMNVLHDFGIQSTHYLQVNYQDSQDWFIL
• Predicted Species: Mouse (94%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: G6PC1
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  G6PC Protein (NBP2-31916PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Rat (88%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for G6PC Antibody - BSA Free

• EC 3.1.3.9
• G6Pase
• G-6-Pase
• G6Pase-alpha
• G6PT
• Glucose-6-phosphatase alpha
• glucose-6-phosphatase
• glucose-6-phosphatase, catalytic (glycogen storage disease type I, von Gierkedisease)
• glucose-6-phosphatase, catalytic subunit
• GSD1
• GSD1a
• MGC163350

Background

Glucose-6-phosphatase is an integral membrane protein of the endoplasmic reticulum that catalyzes the hydrolysis of D-glucose 6-phosphate to D-glucose and orthophosphate. It is a key enzyme in glucose homeostasis, functioning in gluconeogenesis and glycogenolysis. Defects in the enzyme cause glycogen storage disease type I (von Gierke disease). [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: G6PC1
• Uniprot:
  • P35575(Human)