| Reactivity | Hu, MuSpecies Glossary |
| Applications | IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | BSA Free |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: MEEGMNVLHDFGIQSTHYLQVNYQDSQDWFIL |
| Predicted Species | Mouse (94%). Backed by our 100% Guarantee. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | G6PC1 |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Affinity purified |
Secondary Antibodies |
Isotype Controls |
|
Glucose-6-phosphatase (G6PC) - A key to regulate your blood sugar level! The integral endoplasmic reticulum membrane-based enzyme G6PC hydrolyzes its substrate glucose-6-phosphate into glucose. Specifically, G6PC breaks down D-glucose 6-phosphate to D-glucose and orthophosphate. Because G6PC forms with the glucose-6-phosph... Read full blog post. |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.