G6PC Antibody


Immunohistochemistry-Paraffin: G6PC Antibody [NBP2-31916] - Staining of human testis shows no cytoplasmic positivity in cells in seminiferous ducts as expected.
Immunohistochemistry-Paraffin: G6PC Antibody [NBP2-31916] - Staining of human duodenum shows moderate cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: G6PC Antibody [NBP2-31916] - Staining of human liver shows moderate cytoplasmic positivity in hepatocytes.

Product Details

Reactivity Hu, MuSpecies Glossary
Applications IHC, IHC-P

Order Details

G6PC Antibody Summary

This antibody was developed against a recombinant protein corresponding to amino acids: MEEGMNVLHDFGIQSTHYLQVNYQDSQDWFIL
Specificity of human G6PC antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (94%). Backed by our 100% Guarantee.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
G6PC Protein (NBP2-31916PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Rat (88%)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for G6PC Antibody

  • EC
  • G6Pase
  • G-6-Pase
  • G6Pase-alpha
  • G6PT
  • Glucose-6-phosphatase alpha
  • glucose-6-phosphatase
  • glucose-6-phosphatase, catalytic (glycogen storage disease type I, von Gierkedisease)
  • glucose-6-phosphatase, catalytic subunit
  • GSD1
  • GSD1a
  • MGC163350


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, IB, IHC-Fr, IP
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: CyTOF-ready, ICC, ICFlow
Species: Hu, Po
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ELISA, IHC
Species: Hu, Mu
Applications: WB, ELISA, IHC-P, IP
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
Species: Hu
Applications: WB
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: IHC, IHC-P

Publications for G6PC Antibody (NBP2-31916) (0)

There are no publications for G6PC Antibody (NBP2-31916).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for G6PC Antibody (NBP2-31916) (0)

There are no reviews for G6PC Antibody (NBP2-31916). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for G6PC Antibody (NBP2-31916) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional G6PC Products

Bioinformatics Tool for G6PC Antibody (NBP2-31916)

Discover related pathways, diseases and genes to G6PC Antibody (NBP2-31916). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for G6PC Antibody (NBP2-31916)

Discover more about diseases related to G6PC Antibody (NBP2-31916).

Pathways for G6PC Antibody (NBP2-31916)

View related products by pathway.

PTMs for G6PC Antibody (NBP2-31916)

Learn more about PTMs related to G6PC Antibody (NBP2-31916).

Blogs on G6PC.

Glucose-6-phosphatase (G6PC) - A key to regulate your blood sugar level!
The integral endoplasmic reticulum membrane-based enzyme G6PC hydrolyzes its substrate glucose-6-phosphate into glucose. Specifically, G6PC breaks down D-glucose 6-phosphate to D-glucose and orthophosphate. Because G6PC forms with the glucose-6-phosph...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our G6PC Antibody and receive a gift card or discount.


Gene Symbol G6PC