SLC37A4 Antibody


Immunocytochemistry/ Immunofluorescence: SLC37A4 Antibody [NBP2-31972] - Immunofluorescent staining of human cell line U-251 MG shows localization to mitochondria.
Immunohistochemistry-Paraffin: SLC37A4 Antibody [NBP2-31972] - Staining of human lymph node shows low expression as expected.
Immunohistochemistry: SLC37A4 Antibody [NBP2-31972] - Staining of human kidney shows strong cytoplasmic positivity in renal tubules.
Immunohistochemistry-Paraffin: SLC37A4 Antibody [NBP2-31972] - Staining in human kidney and lymph node tissues using anti-SLC37A4 antibody. Corresponding SLC37A4 RNA-seq data are presented for the same tissues.

Product Details

Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF, IHC, IHC-P

Order Details

SLC37A4 Antibody Summary

This antibody was developed against a recombinant protein corresponding to amino acids: LDKDDLGFITSSQSAAYAISKFVSGVLSDQMS
Specificity of human SLC37A4 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (97%), Rat (97%). Backed by our 100% Guarantee.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
SLC37A4 Protein (NBP2-31972PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for SLC37A4 Antibody

  • G6PT
  • G6PT1G6PT3
  • G6PT2
  • Glucose-5-phosphate transporter
  • glucose-6-phosphatase, transport (glucose) protein 3
  • glucose-6-phosphatase, transport (glucose-6-phosphate) protein 1
  • glucose-6-phosphatase, transport (phosphate/pyrophosphate) protein 2
  • glucose-6-phosphate translocase
  • GSD1b
  • GSD1c
  • GSD1d
  • MGC15729
  • microsomal glucose-6-phosphate transporter
  • solute carrier family 37 (glucose-6-phosphate transporter), member 4
  • Solute carrier family 37 member 4
  • Transformation-related gene 19 protein
  • TRG19
  • TRG-19


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Mu
Applications: WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
Species: Hu
Applications: WB, ICC/IF
Species: Hu
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready, IF
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: CyTOF-ready, ICC, ICFlow
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P

Publications for SLC37A4 Antibody (NBP2-31972) (0)

There are no publications for SLC37A4 Antibody (NBP2-31972).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SLC37A4 Antibody (NBP2-31972) (0)

There are no reviews for SLC37A4 Antibody (NBP2-31972). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for SLC37A4 Antibody (NBP2-31972) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional SLC37A4 Products

Bioinformatics Tool for SLC37A4 Antibody (NBP2-31972)

Discover related pathways, diseases and genes to SLC37A4 Antibody (NBP2-31972). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SLC37A4 Antibody (NBP2-31972)

Discover more about diseases related to SLC37A4 Antibody (NBP2-31972).

Pathways for SLC37A4 Antibody (NBP2-31972)

View related products by pathway.

PTMs for SLC37A4 Antibody (NBP2-31972)

Learn more about PTMs related to SLC37A4 Antibody (NBP2-31972).

Blogs on SLC37A4

There are no specific blogs for SLC37A4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our SLC37A4 Antibody and receive a gift card or discount.


Gene Symbol SLC37A4