Orthogonal Strategies: Immunohistochemistry-Paraffin: G3BP2 Antibody [NBP1-82976] - Analysis in human cerebral cortex and skin tissues using NBP1-82976 antibody. Corresponding G3BP2 RNA-seq data are presented for ...read more
Independent Antibodies: Immunohistochemistry-Paraffin: G3BP2 Antibody [NBP1-82976] - Staining of human cerebellum, cerebral cortex, skin and testis using Anti-G3BP2 antibody NBP1-82976 (A) shows similar protein ...read more
Immunohistochemistry-Paraffin: G3BP2 Antibody [NBP1-82976] - Staining of human cerebral cortex shows strong cytoplasmic positivity in neuronal cells.
Immunohistochemistry-Paraffin: G3BP2 Antibody [NBP1-82976] - Staining of human testis shows moderate cytoplasmic positivity in cells in seminiferous ducts and Leydig cells.
Immunohistochemistry-Paraffin: G3BP2 Antibody [NBP1-82976] - Staining of human skin shows very weak cytoplasmic positivity in epidermal cells.
Immunohistochemistry-Paraffin: G3BP2 Antibody [NBP1-82976] - Staining of human cerebellum shows strong cytoplasmic positivity in Purkinje cells and in molecular layer.
NCAP interacts with SG proteins. (A) Interaction of NCAP with G3BP1, G3BP2, YTHDF3, USP10 and PKR. A549 cells transfected with GFP‐NCAP were unstressed, treated with arsenite or heat shock and subjected to co‐IP ...read more
This antibody was developed against Recombinant Protein corresponding to amino acids: KNLEELEEKSTTPPPAEPVSLPQEPPKPRVEAKPEVQSQPPRVREQRPRERPGFPPRGPRPGRGDMEQNDS
Predicted Species
Rat (92%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
G3BP2
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Mouse reactivity reported in scientific literature (PMID: 25893917).
Packaging, Storage & Formulations
Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified
Alternate Names for G3BP2 Antibody - BSA Free
G3BP-2
GAP SH3 domain-binding protein 2
GTPase activating protein (SH3 domain) binding protein 2
KIAA0660
ras GTPase-activating protein-binding protein 2
Ras-GTPase activating protein SH3 domain-binding protein 2
Background
Ras-GAP SH3 domain binding protein (G3BP2) contains an RNA recognition motif (RRM) and an N-terminal nuclear transport factor 2-like (NTF2-like) domain. The G3BP family of proteins have been shown to function downstream of Ras and play a role in RNA metabolism, signal transduction, and proliferation.G3BP2 can interact with IkappaBalpha and IkappaBalpha/NFkappaB complexes. In this complex G3B2 is proposed to play a role in regulating the nucleocytoplasmic localization of NFkappaB as well as its activity.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.