G3BP2 Antibody

Images

 
Western Blot: G3BP2 Antibody [NBP1-82976] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
Immunocytochemistry/ Immunofluorescence: G3BP2 Antibody [NBP1-82976] - Immunofluorescent staining of human cell line U-2 OS shows localization to cytosol.
Immunohistochemistry-Paraffin: G3BP2 Antibody [NBP1-82976] - Staining of human cerebral cortex shows strong cytoplasmic positivity in neuronal cells.
Western Blot: G3BP2 Antibody [NBP1-82976] - Analysis in human cell line SH-SY5Y.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

G3BP2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:KNLEELEEKSTTPPPAEPVSLPQEPPKPRVEAKPEVQSQPPRVREQRPRERPGFPPRGPRPGRGDMEQNDS
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
G3BP2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
G3BP2 Protein (NBP1-82976PEP)
Reviewed Applications
Read 1 Review rated 5
using
NBP1-82976 in the following applications:

Publications
Read Publications using
NBP1-82976 in the following applications:

  • IHC
    1 publication
  • 1 publication
  • WB
    1 publication

Reactivity Notes

Mouse reactivity reported in scientific literature (PMID: 25893917).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for G3BP2 Antibody

  • G3BP-2
  • GAP SH3 domain-binding protein 2
  • GTPase activating protein (SH3 domain) binding protein 2
  • KIAA0660
  • ras GTPase-activating protein-binding protein 2
  • Ras-GTPase activating protein SH3 domain-binding protein 2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00010146-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, RNAi SP
AF5094
Species: Hu, Mu, Rt
Applications: WB
NBP2-29323
Species: Hu, Mu, Rt, Bv, Ca, Ch, Xp
NBP1-84339
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-24493
Species: Hu, Mu, Bv, Ch, Eq, Op, Pm
Applications: WB
H00004507-M01
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
NB500-418
Species: Hu, Po, Rb
Applications: WB, B/N, ELISA, ICC/IF, IHC, IHC-P, RIA
NBP2-22238
Species: Hu, Mu
Applications: WB, IP
NB200-191
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-21598
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
AF7550
Species: Hu
Applications: WB
NBP2-14249
Species: Hu
Applications: IHC, IHC-P
NBP2-37957
Species: Hu
Applications: IHC, IHC-P
AF2000
Species: Hu
Applications: WB, Simple Western, Flow, CyTOF-ready

Publications for G3BP2 Antibody (NBP1-82976)(2)

We have publications tested in 2 confirmed species: Human, Mouse.

We have publications tested in 3 applications: IHC, IHC-P, WB.


Filter By Application
IHC
(1)
IHC-P
(1)
WB
(1)
All Applications
Filter By Species
Human
(1)
Mouse
(1)
All Species

Review for G3BP2 Antibody (NBP1-82976) (1) 51

Average Rating: 5
(Based on 1 review)
We have 1 review tested in 1 species: Mouse.
We have 1 review tested in 1 application: IF.

Reviews using NBP1-82976:
Filter by Applications
IF
(1)
All Applications
Filter by Species
Mouse
(1)
All Species
Images Ratings Applications Species Date Details
Immunofluorescence G3BP2 NBP1-82976
Enlarge
reviewed by:
Anonymous
IF Mouse 09/01/2017
View

Summary

ApplicationImmunofluorescence
Sample TestedCortical neurons
SpeciesMouse
LotA104863

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for G3BP2 Antibody (NBP1-82976) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional G3BP2 Products

Bioinformatics Tool for G3BP2 Antibody (NBP1-82976)

Discover related pathways, diseases and genes to G3BP2 Antibody (NBP1-82976). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for G3BP2 Antibody (NBP1-82976)

Discover more about diseases related to G3BP2 Antibody (NBP1-82976).
 

Pathways for G3BP2 Antibody (NBP1-82976)

View related products by pathway.

PTMs for G3BP2 Antibody (NBP1-82976)

Learn more about PTMs related to G3BP2 Antibody (NBP1-82976).

Blogs on G3BP2

There are no specific blogs for G3BP2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

5
5
1
4
0
3
0
2
0
1
0

Anonymous
09/01/2017
Application: IF
Species: Mouse

Bioinformatics

Gene Symbol G3BP2