G3BP2 Antibody


Western Blot: G3BP2 Antibody [NBP1-82976] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
Immunocytochemistry/ Immunofluorescence: G3BP2 Antibody [NBP1-82976] - G3BP2 staning is detected in neurites and cell bodies in mouse cortical neuros (dilution: 1:500 [red], DAPI: blue). This image was submitted via ...read more
Orthogonal Strategies: Immunohistochemistry-Paraffin: G3BP2 Antibody [NBP1-82976] - Staining in human cerebral cortex and skin tissues using anti-G3BP2 antibody. Corresponding G3BP2 RNA-seq data are presented for ...read more
Western Blot: G3BP2 Antibody [NBP1-82976] - Analysis in human cell line SH-SY5Y.
Immunocytochemistry/ Immunofluorescence: G3BP2 Antibody [NBP1-82976] - Immunofluorescent staining of human cell line U-2 OS shows localization to cytosol. Antibody staining shown in green.
Immunohistochemistry-Paraffin: G3BP2 Antibody [NBP1-82976] - Staining of human cerebral cortex shows high expression.
Immunohistochemistry-Paraffin: G3BP2 Antibody [NBP1-82976] - Staining of human skin shows low expression as expected.

Product Details

Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Validated by:

Orthogonal Strategies


Order Details

G3BP2 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: KNLEELEEKSTTPPPAEPVSLPQEPPKPRVEAKPEVQSQPPRVREQRPRERPGFPPRGPRPGRGDMEQNDS
Specificity of human, mouse, rat G3BP2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
G3BP2 Protein (NBP1-82976PEP)
Reviewed Applications
Read 1 Review rated 5
NBP1-82976 in the following applications:

Read Publications using
NBP1-82976 in the following applications:

  • IHC
    1 publication
  • 1 publication
  • WB
    1 publication

Reactivity Notes

Mouse reactivity reported in scientific literature (PMID: 25893917).

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for G3BP2 Antibody

  • G3BP-2
  • GAP SH3 domain-binding protein 2
  • GTPase activating protein (SH3 domain) binding protein 2
  • KIAA0660
  • ras GTPase-activating protein-binding protein 2
  • Ras-GTPase activating protein SH3 domain-binding protein 2


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, KD
Species: Hu, Mu, Rt
Applications: WB
Species: Hu
Applications: WB, Flow, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Bv, Ch, Eq, Op, Pm
Applications: WB
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
Species: Hu, Po, Rb
Applications: WB, B/N, ELISA, ICC/IF, IHC, IHC-P, RIA
Species: Hu, Mu
Applications: WB, IP
Species: Hu, Mu, Ha
Applications: WB, ICC/IF, IHC, IHC-P, IP, IF
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu
Applications: WB, ICC/IF
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: WB, Simple Western, Flow, CyTOF-ready

Publications for G3BP2 Antibody (NBP1-82976)(2)

We have publications tested in 2 confirmed species: Human, Mouse.

We have publications tested in 3 applications: IHC, IHC-P, WB.

Filter By Application
All Applications
Filter By Species
All Species

Review for G3BP2 Antibody (NBP1-82976) (1) 51

Average Rating: 5
(Based on 1 review)
We have 1 review tested in 1 species: Mouse.

Reviews using NBP1-82976:
Filter by Applications
All Applications
Filter by Species
All Species
Images Ratings Applications Species Date Details
Immunofluorescence G3BP2 NBP1-82976
reviewed by:
IF Mouse 09/01/2017


Sample TestedCortical neurons

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for G3BP2 Antibody (NBP1-82976) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional G3BP2 Products

Bioinformatics Tool for G3BP2 Antibody (NBP1-82976)

Discover related pathways, diseases and genes to G3BP2 Antibody (NBP1-82976). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for G3BP2 Antibody (NBP1-82976)

Discover more about diseases related to G3BP2 Antibody (NBP1-82976).

Pathways for G3BP2 Antibody (NBP1-82976)

View related products by pathway.

PTMs for G3BP2 Antibody (NBP1-82976)

Learn more about PTMs related to G3BP2 Antibody (NBP1-82976).

Blogs on G3BP2

There are no specific blogs for G3BP2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Recent Reviews


Application: IF
Species: Mouse


Gene Symbol G3BP2