G3BP1 Antibody (5A4T0)

Western Blot: G3BP1 Antibody (5A4T0) [NBP3-16302] - Western blot analysis of extracts of various cell lines, using G3BP11 Rabbit mAb (NBP3-16302) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 10s.

Immunocytochemistry/Immunofluorescence: G3BP1 Antibody (5A4T0) [NBP3-16302] - Immunofluorescence analysis of NIH-3T3 cells using G3BP11 Rabbit mAb (NBP3-16302) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

Immunocytochemistry/Immunofluorescence: G3BP1 Antibody (5A4T0) [NBP3-16302] - Immunofluorescence analysis of HeLa cells using G3BP11 Rabbit mAb (NBP3-16302) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

Immunoprecipitation: G3BP1 Antibody (5A4T0) [NBP3-16302] - Immunoprecipitation analysis of 300ug extracts of HeLa cells using 3ug G3BP11 antibody (NBP3-16302). Western blot was performed from the immunoprecipitate using G3BP11 antibody (NBP3-16302) at a dilition of 1:1000.

Immunocytochemistry/ Immunofluorescence: G3BP1 Antibody (5A4T0) [NBP3-16302] - Confocal imaging of HeLa cells (treated with sodium arsenite) and HeLa cells (untreated) using G3BP1 Rabbit mAb followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) . DAPI was used for nuclear staining (Blue). Objective: 100x.

Immunocytochemistry/ Immunofluorescence: G3BP1 Antibody (5A4T0) [NBP3-16302] - Confocal imaging of HeLa cells using G3BP1 Rabbit mAb. The cells were counterstained with alpha-Tubulin Mouse mAb (Green). DAPI was used for nuclear staining (blue). Objective: 100x.

Immunocytochemistry/ Immunofluorescence: G3BP1 Antibody (5A4T0) [NBP3-16302] - Confocal imaging of PC-12 cells (treated with sodium arsenite) and PC-12 cells (untreated) using G3BP1 Rabbit mAb followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) . DAPI was used for nuclear staining (Blue). Objective: 100x.

Immunocytochemistry/ Immunofluorescence: G3BP1 Antibody (5A4T0) [G3BP1] - Confocal imaging of HeLa cells using G3BP1 Rabbit mAb . The cells were counterstained with alpha-Tubulin Mouse mAb (Green). DAPI was used for nuclear staining (blue). Objective: 100x.

Immunocytochemistry/ Immunofluorescence: G3BP1 Antibody (5A4T0) [G3BP1] - Confocal imaging of PC-12 cells (treated with sodium arsenite) and PC-12 cells (untreated) using G3BP1 Rabbit mAb followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) . DAPI was used for nuclear staining (Blue). Objective: 100x.

Immunocytochemistry/ Immunofluorescence: G3BP1 Antibody (5A4T0) [G3BP1] - Confocal imaging of HeLa cells (treated with sodium arsenite) and HeLa cells (untreated) using G3BP1 Rabbit mAb followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) . DAPI was used for nuclear staining (Blue). Objective: 100x.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, IP
• Clone: 5A4T0
• Clonality: Monoclonal
• Host: Rabbit
• Conjugate: Unconjugated

G3BP1 Antibody (5A4T0) Summary

• Additional Information: Recombinant Monoclonal Antibody
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 350-450 of human G3BP1 (Q13283). EVDKSELKDFFQSYGNVVELRINSGGKLPNFGFVVFDDSEPVQKVLSNRPIMFRGEVRLNVEEKKTRAAREGDRRDNRLRGPGGPRGGLGGGMRGPPRGGM
• Isotype: IgG
• Clonality: Monoclonal
• Host: Rabbit
• Gene: G3BP1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 1:50 - 1:200
  • Immunoprecipitation 1:500 - 1:1000
  • Western Blot 1:500 - 1:1000

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol, 0.05% BSA
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for G3BP1 Antibody (5A4T0)

• ATP-dependent DNA helicase VIII
• EC 3.6.1
• EC 3.6.4.12
• EC 3.6.4.13
• G3BP-1
• G3BPRas-GTPase-activating protein SH3-domain-binding protein
• GAP binding protein
• GAP SH3 domain-binding protein 1
• GTPase activating protein (SH3 domain) binding protein 1
• hDH VIII
• HDH-VIII
• MGC111040
• ras GTPase-activating protein-binding protein 1
• RasGAP-associated endoribonuclease G3BP

Background

G3BP1 encodes one of the DNA-unwinding enzymes which prefers partially unwound 3'-tailed substrates and can also unwind partial RNA/DNA and RNA/RNA duplexes in an ATP-dependent fashion. This enzyme is a member of the heterogeneous nuclear RNA-binding proteins and is also an element of the Ras signal transduction pathway. It binds specifically to the Ras-GTPase-activating protein by associating with its SH3 domain. Several alternatively spliced transcript variants of this gene have been described, but the full-length nature of some of these variants has not been determined.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: G3BP1