G3BP2 Antibody

Images

 
Orthogonal Strategies: Immunohistochemistry-Paraffin: G3BP2 Antibody [NBP1-82977] - Analysis in human cerebral cortex and skin tissues using NBP1-82977 antibody. Corresponding G3BP2 RNA-seq data are presented for ...read more
Independent Antibodies: Immunohistochemistry-Paraffin: G3BP2 Antibody [NBP1-82977] - Staining of human cerebellum, cerebral cortex, skin and testis using Anti-G3BP2 antibody NBP1-82977 (A) shows similar protein ...read more
Immunocytochemistry/ Immunofluorescence: G3BP2 Antibody [NBP1-82977] - Immunofluorescent staining of human cell line U-2 OS shows localization to cytosol.
Immunohistochemistry-Paraffin: G3BP2 Antibody [NBP1-82977] - Staining of human skin shows low expression as expected.
Immunohistochemistry-Paraffin: G3BP2 Antibody [NBP1-82977] - Staining of human cerebellum shows strong cytoplasmic positivity in Purkinje cells and cells in molecular layer.
Immunohistochemistry-Paraffin: G3BP2 Antibody [NBP1-82977] - Staining of human cerebral cortex shows strong cytoplasmic positivity in neuronal cells.
Immunohistochemistry-Paraffin: G3BP2 Antibody [NBP1-82977] - Staining of human testis shows strong cytoplasmic positivity in cells in seminiferous ducts in Leydig cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

G3BP2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: HNDMFRYEDEVFGDSEPELDEESEDEVEEEQEERQPSPEPVQENANSGYYEAHPVTNGIEEPLEESSHEPEPEPESETKTEELKPQVE
Predicted Species
Mouse (97%), Rat (97%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
G3BP2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
G3BP2 Protein (NBP1-82977PEP)
Publications
Read Publications using
NBP1-82977 in the following applications:

  • IHC
    1 publication

Reactivity Notes

Human reactivity reported in scientific literature (PMID: 22689141).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for G3BP2 Antibody

  • G3BP-2
  • GAP SH3 domain-binding protein 2
  • GTPase activating protein (SH3 domain) binding protein 2
  • KIAA0660
  • ras GTPase-activating protein-binding protein 2
  • Ras-GTPase activating protein SH3 domain-binding protein 2

Background

Ras-GAP SH3 domain binding protein (G3BP2) contains an RNA recognition motif (RRM) and an N-terminal nuclear transport factor 2-like (NTF2-like) domain. The G3BP family of proteins have been shown to function downstream of Ras and play a role in RNA metabolism, signal transduction, and proliferation.G3BP2 can interact with IkappaBalpha and IkappaBalpha/NFkappaB complexes. In this complex G3B2 is proposed to play a role in regulating the nucleocytoplasmic localization of NFkappaB as well as its activity.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00010146-M01
Species: Hu, Pm, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, KD, WB
AF5094
Species: Hu, Mu, Rt
Applications: WB
NB100-56583
Species: Hu, Rb, Rt
Applications: Flow, IHC, IHC-P, KO, WB
NBP1-84339
Species: Hu
Applications: IHC, IHC-P, WB
MAB8924
Species: Hu
Applications: CyTOF-ready, ICFlow
H00004507-M01
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
2914-HT
Species: Hu
Applications: BA
NBP2-29661
Species: Hu, Mu, Rt
Applications: ELISA
NBP1-88195
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, WB
7754-BH/CF
Species: Hu
Applications: BA
NB200-191
Species: Ha, Hu, Mu
Applications: ICC/IF, IHC, IHC-P, IP, WB
NBP2-21598
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
AF7550
Species: Hu
Applications: KO, WB
NBP1-20863
Species: Hu
Applications: IHC, IHC-P, IP, PEP-ELISA, WB
NBP2-45564
Species: Hu
Applications: ICC/IF, IF, IHC-P, WB
AF2000
Species: Hu
Applications: CyTOF-ready, Flow, Simple Western, WB

Publications for G3BP2 Antibody (NBP1-82977)(2)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: IHC.


Filter By Application
IHC
(1)
All Applications
Filter By Species
Human
(1)
All Species

Reviews for G3BP2 Antibody (NBP1-82977) (0)

There are no reviews for G3BP2 Antibody (NBP1-82977). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for G3BP2 Antibody (NBP1-82977) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional G3BP2 Products

Bioinformatics Tool for G3BP2 Antibody (NBP1-82977)

Discover related pathways, diseases and genes to G3BP2 Antibody (NBP1-82977). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for G3BP2 Antibody (NBP1-82977)

Discover more about diseases related to G3BP2 Antibody (NBP1-82977).
 

Pathways for G3BP2 Antibody (NBP1-82977)

View related products by pathway.

PTMs for G3BP2 Antibody (NBP1-82977)

Learn more about PTMs related to G3BP2 Antibody (NBP1-82977).
 

Research Areas for G3BP2 Antibody (NBP1-82977)

Find related products by research area.

Blogs on G3BP2

There are no specific blogs for G3BP2, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our G3BP2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol G3BP2