G3BP2 Antibody - BSA Free

Immunohistochemistry-Paraffin: G3BP2 Antibody [NBP1-82977] - Analysis in human cerebral cortex and skin tissues using NBP1-82977 antibody. Corresponding G3BP2 RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: G3BP2 Antibody [NBP1-82977] - Staining of human cerebellum, cerebral cortex, skin and testis using Anti-G3BP2 antibody NBP1-82977 (A) shows similar protein distribution across tissues to independent antibody NBP1-82976 (B).

Immunocytochemistry/Immunofluorescence: G3BP2 Antibody [NBP1-82977] - Immunofluorescent staining of human cell line U-2 OS shows localization to cytosol.

Immunohistochemistry-Paraffin: G3BP2 Antibody [NBP1-82977] - Staining of human skin shows low expression as expected.

Immunohistochemistry-Paraffin: G3BP2 Antibody [NBP1-82977] - Staining of human cerebellum shows strong cytoplasmic positivity in Purkinje cells and cells in molecular layer.

Immunohistochemistry-Paraffin: G3BP2 Antibody [NBP1-82977] - Staining of human cerebral cortex shows strong cytoplasmic positivity in neuronal cells.

Immunohistochemistry-Paraffin: G3BP2 Antibody [NBP1-82977] - Staining of human testis shows strong cytoplasmic positivity in cells in seminiferous ducts in Leydig cells.

• Reactivity: Hu, Mu, Rt
• Applications: ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

G3BP2 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: HNDMFRYEDEVFGDSEPELDEESEDEVEEEQEERQPSPEPVQENANSGYYEAHPVTNGIEEPLEESSHEPEPEPESETKTEELKPQVE
• Predicted Species: Mouse (97%), Rat (97%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: G3BP2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  G3BP2 Protein (NBP1-82977PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for G3BP2 Antibody - BSA Free

• G3BP-2
• GAP SH3 domain-binding protein 2
• GTPase activating protein (SH3 domain) binding protein 2
• KIAA0660
• ras GTPase-activating protein-binding protein 2
• Ras-GTPase activating protein SH3 domain-binding protein 2

Background

Ras-GAP SH3 domain binding protein (G3BP2) contains an RNA recognition motif (RRM) and an N-terminal nuclear transport factor 2-like (NTF2-like) domain. The G3BP family of proteins have been shown to function downstream of Ras and play a role in RNA metabolism, signal transduction, and proliferation.G3BP2 can interact with IkappaBalpha and IkappaBalpha/NFkappaB complexes. In this complex G3B2 is proposed to play a role in regulating the nucleocytoplasmic localization of NFkappaB as well as its activity.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for G3BP2 Antibody (NBP1-82977)(3)

Publications using NBP1-82977

• Wang A, Abulaiti X, Zhang H et al. Cancer Cells Evade Stress-Induced Apoptosis by Promoting HSP70-Dependent Clearance of Stress Granules Cancers (Basel) 2022-09-25 [PMID: 36230594]
• Katz E, Sims AH, Sproul D et al. Targeting of Rac GTPases blocks the spread of intact human breast cancer. Oncotarget 2012-06-01 [PMID: 22689141] (IF/IHC, Human)
• Bolander A, Agnarsdottir M, Stromberg S et al. The protein expression of TRP-1 and galectin-1 in cutaneous malignant melanomas. Cancer Genomics Proteomics 2008-11-01 [PMID: 19287070]

Bioinformatics

• Gene Symbol: G3BP2