USP32 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: USP32 Antibody [NBP2-13509] - Immunofluorescent staining of human cell line MCF7 shows localization to the Golgi apparatus.
Immunohistochemistry-Paraffin: USP32 Antibody [NBP2-13509] - Staining of human testis shows cytoplasmic positivity in cells in seminiferous ducts and Leydig cells.
Immunohistochemistry-Frozen: USP32 Antibody [NBP2-13509] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10Lane 2: Human cell line MCF-7

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-Fr, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

USP32 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: VVIEPSSVLNGGKYSFGTAAHPMEQVEDRIGSSLSYVNTTEEKFSDNIST ASEASETAGSGFLYSATPGADVCFARQHNTSDNNNQCLLGANGNILLHLN PQKPGAIDNQPLVTQEPVKATSLTLEGGRLKRTPQLIHGRDYEMVPE
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (90%), Rat (90%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
USP32
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:500 - 1:1000
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Frozen
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
USP32 Protein (NBP2-13509PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for USP32 Antibody

  • Deubiquitinating enzyme 32
  • EC 3.1.2.15
  • EC 3.4.19.12
  • NY-REN-60
  • Renal carcinoma antigen NY-REN-60
  • ubiquitin carboxyl-terminal hydrolase 32
  • ubiquitin specific peptidase 32
  • ubiquitin specific protease 32
  • ubiquitin thioesterase 32
  • Ubiquitin thiolesterase 32
  • USP10Ubiquitin-specific-processing protease 32
  • USP32

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF6008
Species: Hu, Mu, Rt
Applications: WB
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
H00010146-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, RNAi SP
MAB25031
Species: Hu
Applications: WB, IHC, IP
NB100-56603
Species: Hu, Pm
Applications: WB, IHC, IHC-P
H00009098-M01
Species: Hu
Applications: WB, ELISA
NB100-2736
Species: Hu, Rt
Applications: WB, IHC, IHC-Fr, IHC-P, IP
NBP2-34390
Species: Hu
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP
NB600-335
Species: Hu, Mu, Ec, NA
Applications: WB, ELISA, ICC/IF, IHC-Fr, IP
NBP2-22238
Species: Hu, Mu
Applications: WB, IP
NBP2-16468
Species: Hu, Rt
Applications: WB, IHC, IHC-P
NB120-6125
Species: Hu, Bv, Ca, Pm, Xp, Dr(-), Mu(-)
Applications: WB, ELISA, Flow, ICC/IF, IP, MiAr, CyTOF-ready
NBP2-46132
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-37574
Species: Hu, Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC
NB500-240
Species: Hu, Mu
Applications: WB, IP
NBP2-21037
Species: Hu
Applications: WB, IHC, IHC-P
H00008724-M10
Species: Hu
Applications: WB, ELISA
NBP2-13509
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P

Publications for USP32 Antibody (NBP2-13509) (0)

There are no publications for USP32 Antibody (NBP2-13509).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for USP32 Antibody (NBP2-13509) (0)

There are no reviews for USP32 Antibody (NBP2-13509). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for USP32 Antibody (NBP2-13509) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional USP32 Products

Bioinformatics Tool for USP32 Antibody (NBP2-13509)

Discover related pathways, diseases and genes to USP32 Antibody (NBP2-13509). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for USP32 Antibody (NBP2-13509)

Discover more about diseases related to USP32 Antibody (NBP2-13509).
 

Pathways for USP32 Antibody (NBP2-13509)

View related products by pathway.

PTMs for USP32 Antibody (NBP2-13509)

Learn more about PTMs related to USP32 Antibody (NBP2-13509).

Blogs on USP32

There are no specific blogs for USP32, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our USP32 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol USP32
Entrez