G2A/GPR132 Antibody


Immunohistochemistry-Paraffin: G2A/GPR132 Antibody [NBP1-89808] - Staining of human lymph node shows cytoplasmic positivity in germinal center cells and non-germinal center cells.

Product Details

Reactivity HuSpecies Glossary
Applications IHC, IHC-P

Order Details

G2A/GPR132 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: HSRQEVSRIHKGWKEWSMKTDVTRLTHSRDTEELQSPVALADHYTFSRPVHPPGSPCPAKRLIEE
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
G2A/GPR132 Protein (NBP1-89808PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for G2A/GPR132 Antibody

  • G protein-coupled receptor 132
  • G2 accumulation protein
  • G2A
  • G2AG protein-coupled receptor G2A
  • GPR132
  • MGC99642
  • probable G-protein coupled receptor 132


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, PEP-ELISA, IHC-FrFl
Species: Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Cell Depl, CyTOF-ready, InhibTFunc
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF
Species: Hu, Mu, Rt, Po, Bv, Eq, Ha, Pm, Pm, Rb
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Ca, Pm, Pm
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, S-ELISA
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Flow-IC
Species: Hu, Po
Applications: Flow, ICC/IF, IF
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P

Publications for G2A/GPR132 Antibody (NBP1-89808) (0)

There are no publications for G2A/GPR132 Antibody (NBP1-89808).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for G2A/GPR132 Antibody (NBP1-89808) (0)

There are no reviews for G2A/GPR132 Antibody (NBP1-89808). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for G2A/GPR132 Antibody (NBP1-89808) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Other Available Formats

Additional G2A/GPR132 Products

Bioinformatics Tool for G2A/GPR132 Antibody (NBP1-89808)

Discover related pathways, diseases and genes to G2A/GPR132 Antibody (NBP1-89808). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for G2A/GPR132 Antibody (NBP1-89808)

Discover more about diseases related to G2A/GPR132 Antibody (NBP1-89808).

Pathways for G2A/GPR132 Antibody (NBP1-89808)

View related products by pathway.

Research Areas for G2A/GPR132 Antibody (NBP1-89808)

Find related products by research area.

Blogs on G2A/GPR132

There are no specific blogs for G2A/GPR132, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our G2A/GPR132 Antibody and receive a gift card or discount.


Gene Symbol GPR132