FUS Antibody - BSA Free

Western Blot: FUS Antibody [NBP3-03651] - Analysis of extracts from normal (control) and FUS knockout (KO) 293T cells, using FUS antibody at 1:3000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST.

Immunoprecipitation: FUS Antibody [NBP3-03651] - Analysis of 300ug extracts of Jurkat cells using 3ug FUS antibody. Western blot was performed from the immunoprecipitate using FUS antibody at a dilition of 1:2000.

Immunocytochemistry/ Immunofluorescence: FUS Antibody - BSA Free [NBP3-03651] - Immunofluorescence analysis of C6 cells using [KO Validated] FUS Rabbit pAb (A5921) at dilution of 1:100. Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Immunocytochemistry/ Immunofluorescence: FUS Antibody - BSA Free [NBP3-03651] - Immunofluorescence analysis of NIH/3T3 cells using [KO Validated] FUS Rabbit pAb (A5921) at dilution of 1:100. Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, IP, KO
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

FUS Antibody - BSA Free Summary

• Description: Novus Biologicals Knockout (KO) Validated Rabbit FUS Antibody - BSA Free (NBP3-03651) is a polyclonal antibody validated for use in WB, ICC/IF and IP. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 297-526 of human FUS (NP_004951.1). TIESVADYFKQIGIIKTNKKTGQPMINLYTDRETGKLKGEATVSFDDPPSAKAAIDWFDGKEFSGNPIKVSFATRRADFNRGGGNGRGGRGRGGPMGRGGYGGGGSGGGGRGGFPSGGGGGGGQQRAGDWKCPNPTCENMNFSWRNECNQCKAPKPDGPGGGPGGSHMGGNYGDDRRGGRGGYDRGGYRGRGGDRGGFRGGRGGGDRGGFGPGKMDSRGEHRQDRRERPY
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: FUS
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 1:50 - 1:100
  • Immunoprecipitation 1:1000 - 1:5000
  • Knockout Validated
  • Western Blot 1:500 - 1:2000
• Theoretical MW: 53 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for FUS Antibody - BSA Free

• 75 kDa DNA-pairing protein
• ALS6
• amyotrophic lateral sclerosis 6
• FUS1
• fused in sarcoma
• fusion (involved in t(12;16) in malignant liposarcoma)
• fusion gene in myxoid liposarcoma
• fusion, derived from t(12;16) malignant liposarcoma
• fus-like protein
• heterogeneous nuclear ribonucleoprotein P2
• HNRNPP2
• Oncogene FUS
• Oncogene TLS
• POMP75
• RNA-binding protein FUS
• TLShnRNP-P2
• Translocated in liposarcoma protein

Background

FUS, fused in sarcoma, encodes a multifunctional protein component of the heterogeneous nuclear ribonucleoprotein (hnRNP) complex. Nuclear receptor coactivator that directly binds nuclear receptors and stimulates the transcriptional activities in a hormone-dependent fashion. Coactivates expression in an agonist- and AF2-dependent manner. Involved in the coactivation of different nuclear receptors, such as for steroids (GR and ERs), retinoids (RARs and RXRs), thyroid hormone (TRs), vitamin D3 (VDR) and prostanoids (PPARs). Probably functions as a general coactivator, rather than just a nuclear receptor coactivator. May also be involved in the coactivation of the NF-kappa-B pathway. May coactivate expression via a remodeling of chromatin and its interaction with histone acetyltransferase proteins. Involved in placental, cardiac, hepatic and embryonic development. NCOA6 is over-expressed in several breast cancer cell lines.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: FUS