Fumarase Antibody


Western Blot: Fumarase Antibody [NBP1-89814] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10Lane 2: Human Cerebral Cortex tissue
Immunocytochemistry/ Immunofluorescence: Fumarase Antibody [NBP1-89814] - Immunofluorescent staining of human cell line U-2 OS shows localization to mitochondria.
Immunohistochemistry-Paraffin: Fumarase Antibody [NBP1-89814] - Staining of human hippocampus shows positivity in a subsets of neurons.
Western Blot: Fumarase Antibody [NBP1-89814] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG. Lane 4: Human plasma (IgG/HSA depleted). Lane ...read more
Western Blot: Fumarase Antibody [NBP1-89814] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells)Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells)
Immunocytochemistry/ Immunofluorescence: Fumarase Antibody [NBP1-89814] - Staining of mouse globus pallidus shows immunoreactivity in neurons.
Immunocytochemistry/ Immunofluorescence: Fumarase Antibody [NBP1-89814] - Staining of mouse hippocampus shows neuronal immunoreactivity in the CA3 layer.
Immunocytochemistry/ Immunofluorescence: Fumarase Antibody [NBP1-89814] - Staining of mouse medulla shows positivity in the neurons of the facial nucleus.
Immunocytochemistry/ Immunofluorescence: Fumarase Antibody [NBP1-89814] - Staining of mouse midbrain shows neuronal cell bodies in the substantia nigra pars reticulata.
Immunocytochemistry/ Immunofluorescence: Fumarase Antibody [NBP1-89814] - Staining of mouse olfactory bulb shows neuronal positivity in the anterior olfactory nucleus.
Immunohistochemistry-Paraffin: Fumarase Antibody [NBP1-89814] - Staining of human duodenum shows strong granular cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: Fumarase Antibody [NBP1-89814] - Staining of human cerebral cortex shows cytoplasmic positivity in single neurons.

Product Details

Reactivity Hu, Mu, Rt, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P

Order Details

Fumarase Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: DASVSFTENCVVGIQANTERINKLMNESLMLVTALNPHIGYDKAAKIAKTAHKNGSTLKETAIELGYLTAEQFDEWVKPK
Specificity of human, mouse, rat Fumarase antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (99%), Rat (100%). Backed by our 100% Guarantee.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Positive Control
Fumarase Lysate (NBP2-65901)
Control Peptide
Fumarase Protein (NBP1-89814PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for Fumarase Antibody

  • EC
  • fumarase
  • fumarate hydratase
  • fumarate hydratase, mitochondrial
  • LRCC
  • MCL
  • MCUL1


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Rt, Po, Bv
Applications: WB, EM, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vitro, RIA
Species: Hu
Applications: WB, ELISA, Flow, IHC-P, IP
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready, ICC
Species: Hu
Applications: WB, IHC-P
Species: Hu, Mu, Rt, Ze
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC
Species: Hu, Mu
Applications: WB
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
Species: Mu
Applications: WB, Flow, IA, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, ICC/IF, IHC-P
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, KD
Species: Hu
Applications: B/N, Flow, CyTOF-ready
Species: Hu, Mu, Rt, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for Fumarase Antibody (NBP1-89814) (0)

There are no publications for Fumarase Antibody (NBP1-89814).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Fumarase Antibody (NBP1-89814) (0)

There are no reviews for Fumarase Antibody (NBP1-89814). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Fumarase Antibody (NBP1-89814) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Positive Control Lysate(s)

Secondary Antibodies


Isotype Controls

Additional Fumarase Products

Bioinformatics Tool for Fumarase Antibody (NBP1-89814)

Discover related pathways, diseases and genes to Fumarase Antibody (NBP1-89814). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Fumarase Antibody (NBP1-89814)

Discover more about diseases related to Fumarase Antibody (NBP1-89814).

Pathways for Fumarase Antibody (NBP1-89814)

View related products by pathway.

PTMs for Fumarase Antibody (NBP1-89814)

Learn more about PTMs related to Fumarase Antibody (NBP1-89814).

Research Areas for Fumarase Antibody (NBP1-89814)

Find related products by research area.

Blogs on Fumarase

There are no specific blogs for Fumarase, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our Fumarase Antibody and receive a gift card or discount.


Gene Symbol FH