![Immunocytochemistry/Immunofluorescence: ATP Citrate Lyase Antibody [NBP1-90267] - Immunofluorescent staining of human cell line U-251 MG shows localization to plasma membrane & cytosol.](http://images.novusbio.com/fullsize/ATP-Citrate-Lyase-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-90267-img0008.jpg "Immunocytochemistry/Immunofluorescence: ATP Citrate Lyase Antibody [NBP1-90267] - Immunofluorescent staining of human cell line U-251 MG shows localization to plasma membrane & cytosol.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | BSA Free |
| Description | Novus Biologicals Rabbit ATP Citrate Lyase Antibody - BSA Free (NBP1-90267) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: CANQASETAVAKNQALKEAGVFVPRSFDELGEIIQSVYEDLVANGVIVPAQEVPPPTVPMDYSWARELGLIRKPASFMTSICDERGQELIYAGMPITE |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | ACLY |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Affinity purified |
| Publication using NBP1-90267 | Applications | Species |
|---|---|---|
| Andolino C, Cotul E, Xianyu Z et al. Fatty acid synthase-derived lipid stores support breast cancer metastasis. Cancer & metabolism 2025-07-10 [PMID: 40640944] |
Secondary Antibodies |
Isotype Controls |
Research Areas for ATP Citrate Lyase Antibody (NBP1-90267)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | ACLY |
![Immunohistochemistry-Paraffin: ATP Citrate Lyase Antibody [NBP1-90267] - Staining of human kidney, pancreas, prostate and testis using Anti-ACLY antibody NBP1-90267 (A) shows similar protein distribution across tissues to independent antibody NBP1-90268 (B).](http://images.novusbio.com/fullsize/ATP-Citrate-Lyase-Antibody-Immunohistochemistry-Paraffin-NBP1-90267-img0018.jpg "Immunohistochemistry-Paraffin: ATP Citrate Lyase Antibody [NBP1-90267] - Staining of human kidney, pancreas, prostate and testis using Anti-ACLY antibody NBP1-90267 (A) shows similar protein distribution across tissues to independent antibody NBP1-90268 (B).")
![Immunohistochemistry-Paraffin: ATP Citrate Lyase Antibody [NBP1-90267] - Staining of human testis shows strong cytoplasmic positivity in Leydig cells.](http://images.novusbio.com/fullsize/ATP-Citrate-Lyase-Antibody-Immunohistochemistry-Paraffin-NBP1-90267-img0021.jpg "Immunohistochemistry-Paraffin: ATP Citrate Lyase Antibody [NBP1-90267] - Staining of human testis shows strong cytoplasmic positivity in Leydig cells.")
![Immunohistochemistry-Paraffin: ATP Citrate Lyase Antibody [NBP1-90267] - Staining of human kidney shows moderate cytoplasmic positivity in cells in tubules.](http://images.novusbio.com/fullsize/ATP-Citrate-Lyase-Antibody-Immunohistochemistry-Paraffin-NBP1-90267-img0017.jpg "Immunohistochemistry-Paraffin: ATP Citrate Lyase Antibody [NBP1-90267] - Staining of human kidney shows moderate cytoplasmic positivity in cells in tubules.")
![Immunohistochemistry-Paraffin: ATP Citrate Lyase Antibody [NBP1-90267] - Staining of human pancreas shows strong cytoplasmic positivity in islets of Langerhans.](http://images.novusbio.com/fullsize/ATP-Citrate-Lyase-Antibody-Immunohistochemistry-Paraffin-NBP1-90267-img0019.jpg "Immunohistochemistry-Paraffin: ATP Citrate Lyase Antibody [NBP1-90267] - Staining of human pancreas shows strong cytoplasmic positivity in islets of Langerhans.")
![Immunohistochemistry-Paraffin: ATP Citrate Lyase Antibody [NBP1-90267] - Staining of human prostate shows strong cytoplasmic positivity in glandular cells.](http://images.novusbio.com/fullsize/ATP-Citrate-Lyase-Antibody-Immunohistochemistry-Paraffin-NBP1-90267-img0020.jpg "Immunohistochemistry-Paraffin: ATP Citrate Lyase Antibody [NBP1-90267] - Staining of human prostate shows strong cytoplasmic positivity in glandular cells.")
![Western Blot: ATP Citrate Lyase Antibody [NBP1-90267] - Analysis using Anti-ACLY antibody NBP1-90267 (A) shows similar pattern to independent antibody NBP1-90268 (B).](http://images.novusbio.com/fullsize/ATP-Citrate-Lyase-Antibody-Western-Blot-NBP1-90267-img0012.jpg "Western Blot: ATP Citrate Lyase Antibody [NBP1-90267] - Analysis using Anti-ACLY antibody NBP1-90267 (A) shows similar pattern to independent antibody NBP1-90268 (B).")
![Flow Cytometry VEGFR3/Flt-4 Antibody [Unconjugated]](https://images.novusbio.com/images2/VEGF_R3_AF743_Flow_Cytometry_15754.jpg)
![Immunocytochemistry/ Immunofluorescence VEGFR3/Flt-4 Antibody [Unconjugated]](https://images.novusbio.com/images/af743_mouse-vegf-r3-flt-4-affinity-purified-polyclonal-ab-41202410325571.jpg)
![Immunocytochemistry/ Immunofluorescence VEGFR3/Flt-4 Antibody [Unconjugated]](https://images.novusbio.com/images/af743_mouse-vegf-r3-flt-4-affinity-purified-polyclonal-ab-41202410325534.jpg)
![Immunocytochemistry Insulin Antibody (182410) [Unconjugated]](https://images.novusbio.com/images2/Insulin_MAB1417_Immunocytochemistry_9376.jpg)
![Immunohistochemistry Insulin Antibody (182410) [Unconjugated]](https://images.novusbio.com/images2/mab1417_human-bovine-mouse-insulin-mab-clone-182410-immunohistochemistry-308202115145.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")