ATP Citrate Lyase Antibody

Images

 
Western Blot: ATP Citrate Lyase Antibody [NBP1-90267] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).
Immunocytochemistry/ Immunofluorescence: ATP Citrate Lyase Antibody [NBP1-90267] - Immunofluorescent staining of human cell line U-251 MG shows localization to plasma membrane & cytosol.
Immunohistochemistry-Paraffin: ATP Citrate Lyase Antibody [NBP1-90267] - Staining of human pancreas shows strong cytoplasmic positivity in islet cells.
Western Blot: ATP Citrate Lyase Antibody [NBP1-90267] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-51

Product Details

Summary
Reactivity Hu, Mu, Rt, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ATP Citrate Lyase Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:CANQASETAVAKNQALKEAGVFVPRSFDELGEIIQSVYEDLVANGVIVPAQEVPPPTVPMDYSWARELGLIRKPASFMTSICDERGQELIYAGMPITE
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (98%), Rat (98%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ACLY
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:20-1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
ATP Citrate Lyase Protein (NBP1-90267PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ATP Citrate Lyase Antibody

  • ACLEC 2.3.3.8
  • ATP citrate lyase
  • ATP citrate synthase
  • ATP-citrate (pro-S-)-lyase
  • ATP-citrate synthase
  • ATPCL
  • Citrate cleavage enzyme
  • CLATP

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

44260002
Species: Hu
Applications: WB, ELISA
AF743
Species: Mu
Applications: WB, Flow, CyTOF-ready
NBP1-31336
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
MAB2806
Species: Hu
Applications: WB, Flow, CyTOF-ready
NB120-2813
Species: Hu, Mu, Ch, Rb
Applications: WB, ICC/IF, IP
NBP1-97503
Species: Hu, Mu, Rt, Po, Bv, Ca, Ch, GP, Ha, Md, Pm, Rb, Sh, Xp
Applications: WB, IHC, IHC-P, IP
H00010963-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NB400-114
Species: Hu, Mu, Rt, Po, Ch, Ha, Pl, Pm
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-58268
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-32398
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-34980
Species: Hu
NBP1-54755
Species: Hu
Applications: WB
NBP2-46376
Species: Hu
Applications: WB, IHC
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP1-32789
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBL1-11664
Species: Hu
NB100-236
Species: Hu, Mu
Applications: WB, IB, IHC, IHC-Fr, IHC-P, IP
NB120-13550
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for ATP Citrate Lyase Antibody (NBP1-90267) (0)

There are no publications for ATP Citrate Lyase Antibody (NBP1-90267).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ATP Citrate Lyase Antibody (NBP1-90267) (0)

There are no reviews for ATP Citrate Lyase Antibody (NBP1-90267). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for ATP Citrate Lyase Antibody (NBP1-90267) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ATP Citrate Lyase Products

Bioinformatics Tool for ATP Citrate Lyase Antibody (NBP1-90267)

Discover related pathways, diseases and genes to ATP Citrate Lyase Antibody (NBP1-90267). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ATP Citrate Lyase Antibody (NBP1-90267)

Discover more about diseases related to ATP Citrate Lyase Antibody (NBP1-90267).
 

Pathways for ATP Citrate Lyase Antibody (NBP1-90267)

View related products by pathway.

PTMs for ATP Citrate Lyase Antibody (NBP1-90267)

Learn more about PTMs related to ATP Citrate Lyase Antibody (NBP1-90267).

Blogs on ATP Citrate Lyase

There are no specific blogs for ATP Citrate Lyase, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ATP Citrate Lyase Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ACLY