Fucosyltransferase 2/FUT2 Antibody

Images

 
Immunohistochemistry-Paraffin: Fucosyltransferase 2/FUT2 Antibody [NBP1-80775] - Staining of human duodenum shows cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Fucosyltransferase 2/FUT2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: QRLAKIQAMWELPVQIPVLASTSKALGPSQLRGMWTINAIGRLGNQMGEYATLYALAKMNGRPAFIPAQMHSTL
Specificity
Specificity of human Fucosyltransferase 2/FUT2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
FUT2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Theoretical MW
39 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Control Peptide
Fucosyltransferase 2/FUT2 Protein (NBP1-80775PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Fucosyltransferase 2/FUT2 Antibody

  • alpha (1,2) fucosyltransferase
  • Alpha(1,2)FT 2
  • alpha(1,2)FT2
  • B12QTL1
  • EC 2.4.1.69
  • fucosyltransferase 2 (secretor status included)
  • Fucosyltransferase 2
  • FUT2
  • galactoside 2-alpha-L-fucosyltransferase 2
  • GDP-L-fucose:beta-D-galactoside 2-alpha-L-fucosyltransferase 2
  • Se
  • Se2
  • SEC2
  • SEC2SE
  • Secretor blood group alpha-2-fucosyltransferase
  • Secretor factor
  • SEJ

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NB100-1533
Species: Hu, Mu, Po, Sh
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
AF1067
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, Neut
NB600-41532
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-02142
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-57642
Species: Hu
Applications: WB, IHC, IHC-P
AF1067
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, Neut
H00003845-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IP
AF1638
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC
MAB9167
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready, ICC
NBP2-38770
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NB100-65214
Species: Hu, Mu, Rt, Ma
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-29915
Species: Hu
Applications: WB, ICC/IF, IHC-P
NBP2-34014
Species: Hu
Applications: IHC, IHC-P
AF4090
Species: Hu
Applications: WB, IHC, IP, Neut
NBP2-20383
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-30027
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for Fucosyltransferase 2/FUT2 Antibody (NBP1-80775) (0)

There are no publications for Fucosyltransferase 2/FUT2 Antibody (NBP1-80775).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Fucosyltransferase 2/FUT2 Antibody (NBP1-80775) (0)

There are no reviews for Fucosyltransferase 2/FUT2 Antibody (NBP1-80775). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for Fucosyltransferase 2/FUT2 Antibody (NBP1-80775) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for Fucosyltransferase 2/FUT2 Antibody (NBP1-80775)

Discover related pathways, diseases and genes to Fucosyltransferase 2/FUT2 Antibody (NBP1-80775). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Fucosyltransferase 2/FUT2 Antibody (NBP1-80775)

Discover more about diseases related to Fucosyltransferase 2/FUT2 Antibody (NBP1-80775).
 

Pathways for Fucosyltransferase 2/FUT2 Antibody (NBP1-80775)

View related products by pathway.

PTMs for Fucosyltransferase 2/FUT2 Antibody (NBP1-80775)

Learn more about PTMs related to Fucosyltransferase 2/FUT2 Antibody (NBP1-80775).

Blogs on Fucosyltransferase 2/FUT2

There are no specific blogs for Fucosyltransferase 2/FUT2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Fucosyltransferase 2/FUT2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol FUT2
Entrez
Uniprot