Fucosyltransferase 2/FUT2 Antibody


Immunohistochemistry-Paraffin: Fucosyltransferase 2/FUT2 Antibody [NBP1-80775] - Staining of human duodenum shows cytoplasmic positivity in glandular cells.

Product Details

Reactivity HuSpecies Glossary
Applications IHC, IHC-P

Order Details

Fucosyltransferase 2/FUT2 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: QRLAKIQAMWELPVQIPVLASTSKALGPSQLRGMWTINAIGRLGNQMGEYATLYALAKMNGRPAFIPAQMHSTL
Specificity of human Fucosyltransferase 2/FUT2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Theoretical MW
39 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Control Peptide
Fucosyltransferase 2/FUT2 Protein (NBP1-80775PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for Fucosyltransferase 2/FUT2 Antibody

  • alpha (1,2) fucosyltransferase
  • Alpha(1,2)FT 2
  • alpha(1,2)FT2
  • B12QTL1
  • EC
  • fucosyltransferase 2 (secretor status included)
  • Fucosyltransferase 2
  • FUT2
  • galactoside 2-alpha-L-fucosyltransferase 2
  • GDP-L-fucose:beta-D-galactoside 2-alpha-L-fucosyltransferase 2
  • Se
  • Se2
  • SEC2
  • SEC2SE
  • Secretor blood group alpha-2-fucosyltransferase
  • Secretor factor
  • SEJ


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
Species: Hu, Mu, Po, Sh
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, Neut
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, Neut
Species: Hu
Applications: WB, ELISA, ICC/IF, IP
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready, ICC
Species: Hu, Mu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, IHC
Species: Hu
Applications: WB, ICC/IF, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: WB, IHC, IP, Neut
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, IHC-P

Publications for Fucosyltransferase 2/FUT2 Antibody (NBP1-80775) (0)

There are no publications for Fucosyltransferase 2/FUT2 Antibody (NBP1-80775).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Fucosyltransferase 2/FUT2 Antibody (NBP1-80775) (0)

There are no reviews for Fucosyltransferase 2/FUT2 Antibody (NBP1-80775). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for Fucosyltransferase 2/FUT2 Antibody (NBP1-80775) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Array Products

Bioinformatics Tool for Fucosyltransferase 2/FUT2 Antibody (NBP1-80775)

Discover related pathways, diseases and genes to Fucosyltransferase 2/FUT2 Antibody (NBP1-80775). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Fucosyltransferase 2/FUT2 Antibody (NBP1-80775)

Discover more about diseases related to Fucosyltransferase 2/FUT2 Antibody (NBP1-80775).

Pathways for Fucosyltransferase 2/FUT2 Antibody (NBP1-80775)

View related products by pathway.

PTMs for Fucosyltransferase 2/FUT2 Antibody (NBP1-80775)

Learn more about PTMs related to Fucosyltransferase 2/FUT2 Antibody (NBP1-80775).

Blogs on Fucosyltransferase 2/FUT2

There are no specific blogs for Fucosyltransferase 2/FUT2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our Fucosyltransferase 2/FUT2 Antibody and receive a gift card or discount.


Gene Symbol FUT2