We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

FUBP1 Antibody (1G6X5)

Images

 
Western Blot: FUBP1 Antibody (1G6X5) [NBP3-33539] - Western blot analysis of various lysates using FUBP1 Rabbit mAb at 1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 ...read more
Immunocytochemistry/ Immunofluorescence: FUBP1 Antibody (1G6X5) [NBP3-33539] - Confocal imaging of HeLa cells using FUBP1 Rabbit mAb followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (Red). The cells ...read more
Immunohistochemistry: FUBP1 Antibody (1G6X5) [NBP3-33539] - Immunohistochemistry analysis of FUBP1 in paraffin-embedded rat lung tissue using FUBP1 Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen ...read more
Immunohistochemistry: FUBP1 Antibody (1G6X5) [NBP3-33539] - Immunohistochemistry analysis of FUBP1 in paraffin-embedded human thyroid tissue using FUBP1 Rabbit mAb at a dilution of 1:200 (40x lens). High pressure ...read more
Immunohistochemistry: FUBP1 Antibody (1G6X5) [NBP3-33539] - Immunohistochemistry analysis of FUBP1 in paraffin-embedded rat liver tissue using FUBP1 Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen ...read more
Immunohistochemistry: FUBP1 Antibody (1G6X5) [NBP3-33539] - Immunohistochemistry analysis of FUBP1 in paraffin-embedded human esophagus tissue using FUBP1 Rabbit mAb at a dilution of 1:200 (40x lens). High pressure ...read more
Immunohistochemistry: FUBP1 Antibody (1G6X5) [NBP3-33539] - Immunohistochemistry analysis of FUBP1 in paraffin-embedded human breast cancer tissue using FUBP1 Rabbit mAb at a dilution of 1:200 (40x lens). High pressure ...read more
Immunohistochemistry: FUBP1 Antibody (1G6X5) [NBP3-33539] - Immunohistochemistry analysis of FUBP1 in paraffin-embedded mouse intestin tissue using FUBP1 Rabbit mAb at a dilution of 1:200 (40x lens). High pressure ...read more
Immunocytochemistry/ Immunofluorescence: FUBP1 Antibody (1G6X5) [NBP3-33539] - Confocal imaging of U-2 OS cells using FUBP1 Rabbit mAb followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (Red). The ...read more
Immunohistochemistry: FUBP1 Antibody (1G6X5) [NBP3-33539] - Immunohistochemistry analysis of FUBP1 in paraffin-embedded rat intestine tissue using FUBP1 Rabbit mAb at a dilution of 1:200 (40x lens). High pressure ...read more
Immunocytochemistry/ Immunofluorescence: FUBP1 Antibody (1G6X5) [NBP3-33539] - Confocal imaging of paraffin-embedded Human breast cancer tissue using FUBP1 Rabbit mAb followed by a further incubation with Cy3 Goat ...read more
Immunohistochemistry: FUBP1 Antibody (1G6X5) [NBP3-33539] - Immunohistochemistry analysis of FUBP1 in paraffin-embedded mouse lung tissue using FUBP1 Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen ...read more
Immunohistochemistry: FUBP1 Antibody (1G6X5) [NBP3-33539] - Immunohistochemistry analysis of FUBP1 in paraffin-embedded mouse spleen tissue using FUBP1 Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen ...read more

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ELISA, ICC/IF, IHC
Clone
1G6X5
Clonality
Monoclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

FUBP1 Antibody (1G6X5) Summary

Immunogen
A synthetic peptide corresponding to a sequence within amino acids 545-644 of human FUBP1 (Q96AE4).

Sequence:
YQQQAQPPPAAPAGAPTTTQTNGQGDQQNPAPAGQVDYTKAWEEYYKKMGQAVPAPTGAPPGGQPDYSAAWAEYYRQQAAYYAQTSPQGMPQHPPAPQGQ
Isotype
IgG
Clonality
Monoclonal
Host
Rabbit
Gene
FUBP1
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA Recommended starting concentration is 1 ug/mL
  • Immunocytochemistry/ Immunofluorescence 1:100 - 1:500
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 1:500 - 1:1000
Theoretical MW
68 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.3), 50% glycerol, 0.05% BSA
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for FUBP1 Antibody (1G6X5)

  • far upstream element (FUSE) binding protein 1
  • far upstream element binding protein
  • far upstream element-binding protein 1
  • FBPDNA helicase V
  • FUBP
  • FUSE-binding protein 1
  • hDH V

Background

FUBP1 encodes a ssDNA binding protein that activates the far upstream element (FUSE) of c-myc and stimulates expression of c-myc in undifferentiated cells. Regulation of FUSE by FUBP occurs through single-strand binding of FUBP to the non-coding strand. This protein has been shown to function as an ATP-dependent DNA helicase.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB5646
Species: Hu
Applications: CyTOF-ready, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, ICC, KO, WB
NB600-302
Species: Bv, Dr, Hu, Mu
Applications: ChIP, ELISA, Flow-IC, Flow, IB, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, PLA, S-ELISA, Simple Western, WB
4308-SE
Species: Hu
Applications: EnzAct
AF842
Species: Hu
Applications: ELISA, WB
AF3428
Species: Hu
Applications: ICC, Simple Western, WB
NBP1-62583
Species: Hu
Applications: WB
NBP2-49303
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-84721
Species: Hu
Applications: IHC,  IHC-P, Simple Western, WB
NBP1-89296
Species: Hu
Applications: IHC,  IHC-P, WB
NBP1-18910
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, IP, Simple Western, WB
H00051776-M03
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
NBP2-20383
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, WB
AF3398
Species: Hu, Mu, Rt
Applications: ICC, KO, Simple Western, WB
NBP1-84680
Species: Hu
Applications: IHC,  IHC-P, WB
NBP3-15687
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
AF6517
Species: Hu
Applications: WB
NB100-40840
Species: Hu, Mu
Applications: IHC,  IHC-P, IP, WB
NB100-56490
Species: Ca, Hu, Pm
Applications: IHC,  IHC-P, WB

Publications for FUBP1 Antibody (NBP3-33539) (0)

There are no publications for FUBP1 Antibody (NBP3-33539).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FUBP1 Antibody (NBP3-33539) (0)

There are no reviews for FUBP1 Antibody (NBP3-33539). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for FUBP1 Antibody (NBP3-33539) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional FUBP1 Products

Research Areas for FUBP1 Antibody (NBP3-33539)

Find related products by research area.

Blogs on FUBP1

There are no specific blogs for FUBP1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our FUBP1 Antibody (1G6X5) and receive a gift card or discount.

Bioinformatics

Gene Symbol FUBP1