PUF60 Antibody - BSA Free

Western Blot: PUF60 Antibody [NBP2-49303] - Analysis using Anti-PUF60 antibody NBP2-49303 (A) shows similar pattern to independent antibody NBP2-49032 (B).

Immunocytochemistry/Immunofluorescence: PUF60 Antibody [NBP2-49303] - Staining of human cell line U-251 MG shows localization to nucleoplasm. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: PUF60 Antibody [NBP2-49303] - Staining of human cerebral cortex.

Immunohistochemistry-Paraffin: PUF60 Antibody [NBP2-49303] - Staining of human pancreas shows low expression as expected.

Immunohistochemistry-Paraffin: PUF60 Antibody [NBP2-49303] - Staining of human testis shows high expression.

Immunohistochemistry-Paraffin: PUF60 Antibody [NBP2-49303] - Staining in human testis and pancreas tissues using anti-PUF60 antibody. Corresponding PUF60 RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: PUF60 Antibody [NBP2-49303] - Staining of human cerebral cortex, colon, kidney and testis using Anti-PUF60 antibody NBP2-49303 (A) shows similar protein distribution across tissues to independent antibody NBP2-49032 (B).

Immunohistochemistry-Paraffin: PUF60 Antibody [NBP2-49303] - Staining of human colon.

Immunohistochemistry-Paraffin: PUF60 Antibody [NBP2-49303] - Staining of human kidney.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

PUF60 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit PUF60 Antibody - BSA Free (NBP2-49303) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: PIIDQLAEEARAFNRIYVASVHQDLSDDDIKSVFEAFGKIKSCTLARDPTTGKHKGYGFIEYEKAQSSQDAVSSMNLFDLGG
• Predicted Species: Mouse (100%), Rat (100%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: PUF60
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  PUF60 Recombinant Protein Antigen (NBP2-49303PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for PUF60 Antibody - BSA Free

• FBP interacting repressor
• FBP-interacting repressor
• FIRpoly-U binding splicing factor PUF60
• FLJ31379
• FUSE-binding protein-interacting repressor
• poly(U)-binding-splicing factor PUF60
• poly-U binding splicing factor 60KDa
• Ro ribonucleoprotein binding protein 1
• Ro ribonucleoprotein-binding protein 1
• Ro-binding protein 1
• roBP1
• RoBPI
• siah binding protein 1,60 kDa poly(U)-binding-splicing factor
• Siah-binding protein 1
• siah-BP1
• SIAHBP1pyrimidine tract binding splicing factor

Background

PUF60 is a Ro RNP-binding protein. It interacts with Ro RNPs and their interaction is thought to represent a gain of function for Ro RNPs. PUF60 also forms a ternary complex with far upstream element (FUSE) and FUSE-binding protein. It can repress a c-myc reporter via the FUSE. It is also known to target transcription factor IIH and inhibit activated transcription. PUF60 gene is implicated in the xeroderma pigmentosum disorder. There are two alternatively spliced transcript variants of this gene encoding different isoforms. There seems to be evidence of multiple polyadenylation sites for PUF60 gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: PUF60