FSH beta Antibody

Images

 
Immunohistochemistry-Paraffin: FSH beta Antibody [NBP2-57723] - Staining of human pituitary gland shows strong cytoplasmic positivity in cells in anterior lobe.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

FSH beta Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: TRDLVYKDPARPKIQKTCTFKELVYETVRVPGCAHHADSLYTYPVATQCHCGK
Specificity
Specificity of human FSH beta antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
FSHB
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide

Reactivity Notes

Mouse 87%, Rat 85%

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for FSH beta Antibody

  • follicle stimulating hormone, beta polypeptide
  • Follicle-stimulating hormone beta subunit
  • Follitropin beta chain
  • follitropin subunit beta
  • Follitropin
  • follitropin, beta chain
  • FSH beta
  • FSHB
  • FSH-B
  • FSH-beta

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-30475
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-38770
Species: Hu, Mu
Applications: WB, IHC, IHC-P
AF8016
Species: Hu
Applications: WB, IHC
NBP2-45298
Species: Hu, Rt
Applications: Flow, IHC-P, IF
NBP2-36489
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-02142
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-67282
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB120-15160
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P
NB100-1533
Species: Hu, Mu, Rt, Po, Sh
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
AF1067
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, Neut
AF6380
Species: Mu
Applications: WB
H00005087-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NBP1-52823
Species: Hu, Rt, Po, Bv, Ca, Eq, GP, Rb, Sh
Applications: WB, ICC/IF, IHC, IHC-P
NB100-1277
Species: Hu, Mu, Ft
Applications: WB, ChIP, ICC/IF, IHC, IHC-Fr, IHC-P, PEP-ELISA, IHC-WhMt
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P

Publications for FSH beta Antibody (NBP2-57723) (0)

There are no publications for FSH beta Antibody (NBP2-57723).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FSH beta Antibody (NBP2-57723) (0)

There are no reviews for FSH beta Antibody (NBP2-57723). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for FSH beta Antibody (NBP2-57723) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional FSH beta Products

Bioinformatics Tool for FSH beta Antibody (NBP2-57723)

Discover related pathways, diseases and genes to FSH beta Antibody (NBP2-57723). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for FSH beta Antibody (NBP2-57723)

Discover more about diseases related to FSH beta Antibody (NBP2-57723).
 

Pathways for FSH beta Antibody (NBP2-57723)

View related products by pathway.

PTMs for FSH beta Antibody (NBP2-57723)

Learn more about PTMs related to FSH beta Antibody (NBP2-57723).
 

Research Areas for FSH beta Antibody (NBP2-57723)

Find related products by research area.

Blogs on FSH beta

There are no specific blogs for FSH beta, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our FSH beta Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol FSHB