FoxP2 Antibody

Images

 
Western Blot: FoxP2 Antibody [NBP1-86671] - Analysis in human cell line RH-30.
Immunohistochemistry-Paraffin: FoxP2 Antibody [NBP1-86671] - Staining of human skin shows moderate nuclear positivity in deep epidermal cells.
Immunohistochemistry-Paraffin: FoxP2 Antibody [NBP1-86671] - Staining of human cerebral cortex shows moderate to strong nuclear positivity in neurons.
Immunohistochemistry-Paraffin: FoxP2 Antibody [NBP1-86671] - Staining of human rectum shows moderate nuclear positivity in glandular cells.
Immunohistochemistry-Paraffin: FoxP2 Antibody [NBP1-86671] - Staining of human skeletal muscle shows no positivity in striated muscle fibers as expected.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

FoxP2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: AQQLVFQQQLLQMQQLQQQQHLLSLQRQGLISIPPGQAALPVQSLPQAGLSPAEIQQLWKEVTGVHSMEDNGIKHGGLDLTTNNSSSTTSSNTSKASPPITHHS
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
FOXP2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200-1:500
  • Western Blot 0.04-0.4 ug/ml
Application Notes
IICC/IF reported in the scientific literature (PMID: 25926446 and 25926446). IHC reported in scientific literature (PMID: 26407299). For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
FoxP2 Protein (NBP1-86671PEP)
Publications
Read Publications using
NBP1-86671 in the following applications:

Reactivity Notes

Rat reactivity reported in scientific literature (PMID: 25926446). Mouse reactivity reported in the scientific literature (PMID: 26407299)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for FoxP2 Antibody

  • CAG repeat protein 44
  • CAGH44
  • CAGH44TNRC10forkhead box protein P2
  • DKFZp686H1726
  • forkhead box P2
  • forkhead/winged-helix transcription factor
  • FoxP2
  • SPCH1
  • TNRC10
  • trinucleotide repeat containing 10
  • Trinucleotide repeat-containing gene 10 protein

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-65125
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
NB100-39002
Species: Bv, Hu, Mu, Rt
Applications: Dual ISH-IHC, Flow, IB, ICC/IF, IHC, IHC-P, IP, Single-Cell Western, WB
NBP1-88182
Species: Hu
Applications: IHC, IHC-P, WB
AF6854
Species: Hu
Applications: WB
NBP1-87201
Species: Hu
Applications: IHC, IHC-P, WB
202-IL
Species: Hu
Applications: BA
NBP2-44501
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IF, IHC, IHC-P
MAB25031
Species: Hu
Applications: IHC, IP, WB
NBP1-87076
Species: Hu
Applications: IHC, IHC-P, WB
NB100-2278
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
NBP1-68766
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, PEP-ELISA, WB
1845-SH/CF
Species: Hu
Applications: BA
NB300-750
Species: Fi, Hu, Pm, Mu, Pm, Rt, Sh
Applications: ICC/IF, IHC, IP, WB
NBP2-50028
Species: Bv, Hu, Mu, Rt
Applications: ICC/IF, IHC-FrFl, IHC, IHC-P, WB
NBP1-19371
Species: Ca, Hu, Mu, Po, Rb, Rt
Applications: Dual ISH-IHC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
NBP3-07477
Species: Hu
Applications: Flow, ICC/IF, PA, WB
AF3464
Species: Hu
Applications: IHC, WB
NBP1-77370
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
MAB4218
Species: Hu
Applications: IHC, WB
7268-CT
Species: Hu
Applications: BA

Publications for FoxP2 Antibody (NBP1-86671)(4)

Reviews for FoxP2 Antibody (NBP1-86671) (0)

There are no reviews for FoxP2 Antibody (NBP1-86671). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for FoxP2 Antibody (NBP1-86671) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional FoxP2 Products

Bioinformatics Tool for FoxP2 Antibody (NBP1-86671)

Discover related pathways, diseases and genes to FoxP2 Antibody (NBP1-86671). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for FoxP2 Antibody (NBP1-86671)

Discover more about diseases related to FoxP2 Antibody (NBP1-86671).
 

Pathways for FoxP2 Antibody (NBP1-86671)

View related products by pathway.

PTMs for FoxP2 Antibody (NBP1-86671)

Learn more about PTMs related to FoxP2 Antibody (NBP1-86671).

Blogs on FoxP2

There are no specific blogs for FoxP2, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our FoxP2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol FOXP2