FoxP2 Antibody

Images

 
Immunohistochemistry-Paraffin: FoxP2 Antibody [NBP1-86671] - Staining of human oral mucosa shows moderate nuclear positivity in squamous epithelial cells.

Product Details

Summary
Reactivity Hu, Rt, MuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

FoxP2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:AQQLVFQQQLLQMQQLQQQQHLLSLQRQGLISIPPGQAALPVQSLPQAGLSPAEIQQLWKEVTGVHSMEDNGIKHGGLDLTTNNSSSTTSSNTSKASPPITHHS
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (99%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
FOXP2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
FoxP2 Protein (NBP1-86671PEP)
Publications
Read Publications using
NBP1-86671 in the following applications:

Reactivity Notes

Rat reactivity reported in scientific literature (PMID: 25926446).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for FoxP2 Antibody

  • CAG repeat protein 44
  • CAGH44
  • CAGH44TNRC10forkhead box protein P2
  • DKFZp686H1726
  • forkhead box P2
  • forkhead/winged-helix transcription factor
  • FoxP2
  • SPCH1
  • TNRC10
  • trinucleotide repeat containing 10
  • Trinucleotide repeat-containing gene 10 protein

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-65125
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready
NB100-39002
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP1-88182
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-83449
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-87201
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-44501
Species: Hu, Mu, Rt
Applications: Flow, IHC-P, IF
MAB25031
Species: Hu
Applications: WB, IHC, IP
NBP1-87076
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-2278
Species: Hu, Mu
Applications: ICC/IF, IHC
NBP2-47476
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB300-750
Species: Hu, Mu, Rt, Mk, Pm, Sh
Applications: WB, ICC/IF, IP
NBP2-50048
Species: Hu, Mu, Rt, Po, Bv, Ch, Eq
Applications: WB, ICC/IF
NBP1-19371
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NB100-93472
Species: Mu
Applications: WB, IHC, IHC-P, PEP-ELISA
NBP1-86999
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
MAB4218
Species: Hu
Applications: WB, IHC
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC

Publications for FoxP2 Antibody (NBP1-86671)(4)

Reviews for FoxP2 Antibody (NBP1-86671) (0)

There are no reviews for FoxP2 Antibody (NBP1-86671). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for FoxP2 Antibody (NBP1-86671) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional FoxP2 Products

Bioinformatics Tool for FoxP2 Antibody (NBP1-86671)

Discover related pathways, diseases and genes to FoxP2 Antibody (NBP1-86671). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for FoxP2 Antibody (NBP1-86671)

Discover more about diseases related to FoxP2 Antibody (NBP1-86671).
 

Pathways for FoxP2 Antibody (NBP1-86671)

View related products by pathway.

PTMs for FoxP2 Antibody (NBP1-86671)

Learn more about PTMs related to FoxP2 Antibody (NBP1-86671).

Blogs on FoxP2

There are no specific blogs for FoxP2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our FoxP2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol FOXP2
Entrez