FNTA Antibody - BSA Free

Western Blot: FNTA Antibody [NBP3-04921] - Analysis of extracts of various cell lines, using FNTA antibody at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit

• Reactivity: Hu, Mu, Rt
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

FNTA Antibody - BSA Free Summary

• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 280-379 of human FNTA (NP_002018.1). LKGILQDRGLSKYPNLLNQLLDLQPSHSSPYLIAFLVDIYEDMLENQCDNKEDILNKALELCEILAKEKDTIRKEYWRYIGRSLQSKHSTENDSPTNVQQ
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: FNTA
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1:500-1:2000

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for FNTA Antibody - BSA Free

• CAAX farnesyltransferase subunit alpha
• EC 2.5.1.58
• EC 2.5.1.59
• farnesyl-protein transferase alpha-subunit
• farnesyltransferase, CAAX box, alpha
• FNTA
• FPTA
• FTase-alpha
• GGTase-I-alpha
• MGC99680
• PGGT1A
• protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha
• protein prenyltransferase alpha subunit repeat containing 2
• PTAR2
• Ras proteins prenyltransferase subunit alpha
• type I protein geranyl-geranyltransferase alpha subunit
• Type I protein geranyl-geranyltransferase subunit alpha

Background

Prenyltransferases attach either a farnesyl group or a geranylgeranyl group in thioether linkage to the cysteine residue of protein's with a C-terminal CAAX box. CAAX geranylgeranyltransferase and CAAX farnesyltransferase are heterodimers that share the same alpha subunit but have different beta subunits. This gene encodes the alpha subunit of these transferases. Alternative splicing results in multiple transcript variants encoding different isoforms.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: FNTA