FNTA Antibody - BSA Free

Western Blot: FNTA Antibody [NBP1-83428] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). Lane 5: Human liver tissue. Lane 6: Human tonsil tissue

Immunocytochemistry/Immunofluorescence: FNTA Antibody [NBP1-83428] - Immunofluorescent staining of human cell line U-251 MG shows localization to cytosol.

Immunohistochemistry-Paraffin: FNTA Antibody [NBP1-83428] - Staining of human prostate shows nuclear and cytoplasmic positivity in glandular cells.

• Reactivity: Hu
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

FNTA Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit FNTA Antibody - BSA Free (NBP1-83428) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: LDSPSYVLYRHFRRVLLKSLQKDLHEEMNYITAIIEEQPKNYQVWHHRRVLVEWLRDPSQELEFIADI
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: FNTA
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  FNTA Protein (NBP1-83428PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (84%), Rat (84%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for FNTA Antibody - BSA Free

• CAAX farnesyltransferase subunit alpha
• EC 2.5.1.58
• EC 2.5.1.59
• farnesyl-protein transferase alpha-subunit
• farnesyltransferase, CAAX box, alpha
• FNTA
• FPTA
• FTase-alpha
• GGTase-I-alpha
• MGC99680
• PGGT1A
• protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha
• protein prenyltransferase alpha subunit repeat containing 2
• PTAR2
• Ras proteins prenyltransferase subunit alpha
• type I protein geranyl-geranyltransferase alpha subunit
• Type I protein geranyl-geranyltransferase subunit alpha

Background

Prenyltransferases attach either a farnesyl group or a geranylgeranyl group in thioether linkage to the cysteine residue of protein's with a C-terminal CAAX box. CAAX geranylgeranyltransferase and CAAX farnesyltransferase are heterodimers that share the same alpha subunit but have different beta subunits. This gene encodes the alpha subunit of these transferases. Alternative splicing results in multiple transcript variants encoding different isoforms.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: FNTA