FMO1 Antibody - BSA Free

Immunohistochemistry-Paraffin: FMO1 Antibody [NBP1-86412] - Staining of human liver shows moderate cytoplasmic positivity in hepatocytes.

Immunohistochemistry-Paraffin: FMO1 Antibody [NBP1-86412] - Staining of human duodenum shows strong cytoplasmic positivity in glandular cells.

Immunohistochemistry-Paraffin: FMO1 Antibody [NBP1-86412] - Staining of human Fallopian tube shows strong cytoplasmic positivity in a subset of glandular cells.

Immunohistochemistry-Paraffin: FMO1 Antibody [NBP1-86412] - Staining of human kidney shows strong cytoplasmic positivity in cells in tubules.

• Reactivity: Hu
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

FMO1 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: LPTPIVTWLMERKINNWLNHANYGLIPEDRTQLKEFVLNDELPGRIITGKVFIRPSIKEVKENSVIFNNTSKEEPIDIIVFATGYTFAFPFLDESVVKVEDG
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: FMO1
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
• Application Notes: IHC reported in scientific literature (PMID: 23952781). For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  FMO1 Protein (NBP1-86412PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (85%), Rat (80%). Human reactivity reported in scientific literature (PMID: 23952781).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for FMO1 Antibody - BSA Free

• dimethylaniline monooxygenase [N-oxide-forming] 1
• Dimethylaniline oxidase 1
• EC 1.14.13.8
• Fetal hepatic flavin-containing monooxygenase 1
• flavin containing monooxygenase 1
• Flavin-containing monooxygenase 1 (fetal liver)
• FMO 1

Background

Metabolic N-oxidation of the diet-derived amino-trimethylamine (TMA) is mediated by flavin-containing monooxygenase andis subject to an inherited FMO3 polymorphism in man resulting in a small subpopulation with reduced TMA N-oxidationcapacity resulting in fish odor syndrome Trimethylaminuria. Three forms of the enzyme, FMO1 found in fetal liver, FMO2found in adult liver, and FMO3 are encoded by genes clustered in the 1q23-q25 region. Flavin-containing monooxygenasesare NADPH-dependent flavoenzymes that catalyzes the oxidation of soft nucleophilic heteroatom centers in drugs,pesticides, and xenobiotics. (provided by RefSeq)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for FMO1 Antibody (NBP1-86412)(1)

Publication using NBP1-86412

• Rodrigues RM, De Kock J, Branson S et al. Human Skin-Derived Stem Cells as a Novel Cell Source for In Vitro Hepatotoxicity Screening of Pharmaceuticals. Stem Cells Dev 2014-01-01 [PMID: 23952781] (IF/IHC, Human)

Bioinformatics

• Gene Symbol: FMO1