FMO5 Antibody - BSA Free Summary
Immunogen |
This antibody was developed against Recombinant Protein corresponding to amino acids: PLGAIMPISELQGRWATQVFKGLKTLPSQSEMMAEISKAQEEIDKRYVESQRHTIQGDYIDTMEELADLVGVRPNLLSLAFTDPKLALHLLLGPCTPIHYRVQGPGKWDGARKAILTTDD |
Isotype |
IgG |
Clonality |
Polyclonal |
Host |
Rabbit |
Gene |
FMO5 |
Purity |
Immunogen affinity purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
- Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
- Immunohistochemistry 1:50 - 1:200
- Immunohistochemistry-Paraffin 1:50 - 1:200
|
Application Notes |
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
Control Peptide |
|
Publications |
|
Reactivity Notes
Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (85%), Rat (86%)
Packaging, Storage & Formulations
Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Buffer |
PBS (pH 7.2) and 40% Glycerol |
Preservative |
0.02% Sodium Azide |
Purity |
Immunogen affinity purified |
Alternate Names for FMO5 Antibody - BSA Free
Background
FMO5, also known as Dimethylaniline monooxygenase [N-oxide-forming] 5, has a 533 amino acid long isoform that is 60 kDa and a short 285 amino acid isoform that is 32 kDa; is most often expressed in adult and fetal liver, and in contrast with other forms of FMO it does not seem to be a drug-metabolizing enzyme. This protein has been studied for its involvement in trimethylaminuria, hearing loss, hepatitis, and atrioventricular septal defect. FMO5 interacts with CYP3A5, CYP3A43, CYP2D6, CYP3A7, and CYP3A4 and it has been linked to Busulfan Q06828 (pharmacodynamics) and drug metabolism - cytochrome P450 pathways .
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu, Pm, Mu, Pm, Rt
Applications: Flow, IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: WB
Species: Ca, Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt, V-Vi
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Pm, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ELISA, ICC, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: WB
Species: Bv, Hu, Ma, Mu, Po, Rt
Applications: B/N, ChIP, CyTOF-ready, DB, Dual ISH-IHC, ELISA(Cap), ELISA, Flow-CS, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, KD, KO, PAGE, Simple Western, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC
Publications for FMO5 Antibody (NBP1-86093)(1)
Showing Publication 1 -
1 of 1.
Publication using NBP1-86093 |
Applications |
Species |
Zhao RC, Wang J, Dong H, Li Z Flavin-Containing Dimethylaniline Monooxygenase 5 Drives Malignancies in Hepatocellular Carcinoma by Blocking IQGAP1 Ubiquitination via Increasing its SUMOylation School of Life Sciences, Shanghai University, China 2023-01-01 |
|
|
Reviews for FMO5 Antibody (NBP1-86093) (0)
There are no reviews for FMO5 Antibody (NBP1-86093).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for FMO5 Antibody (NBP1-86093) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional FMO5 Products
Research Areas for FMO5 Antibody (NBP1-86093)
Find related products by research area.
|
Blogs on FMO5