Home » FMO5 » FMO5 Antibodies » FMO5 Antibody

FMO5 Antibody

 Submit a Review

Images

 
(
Enlarge)
Immunocytochemistry/Immunofluorescence: FMO5 Antibody [NBP1-86093] - Immunofluorescent staining of human cell line A-431 shows localization to endoplasmic reticulum.
Immunocytochemistry/ Immunofluorescence: FMO5 Antibody [NBP1-86093] - Immunofluorescent staining of human cell line A-431 shows localization to endoplasmic reticulum.
Immunohistochemistry-Paraffin: FMO5 Antibody [NBP1-86093] - Staining of human liver shows high expression.
Immunohistochemistry-Paraffin: FMO5 Antibody [NBP1-86093] - Staining of human cerebral cortex shows low expression as expected.
Immunohistochemistry-Paraffin: FMO5 Antibody [NBP1-86093] - Staining in human liver and cerebral cortex tissues using anti-FMO5 antibody. Corresponding FMO5 RNA-seq data are presented for the same tissues.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

FMO5 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: PLGAIMPISELQGRWATQVFKGLKTLPSQSEMMAEISKAQEEIDKRYVESQRHTIQGDYIDTMEELADLVGVRPNLLSLAFTDPKLALHLLLGPCTPIHYRVQGPGKWDGARKAILTTDD
Specificity
Specificity of human FMO5 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
FMO5
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
FMO5 Protein (NBP1-86093PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (85%), Rat (86%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for FMO5 Antibody

  • dimethylaniline monooxygenase [N-oxide-forming] 5
  • Dimethylaniline oxidase 5
  • EC 1.14.13.8
  • flavin containing monooxygenase 5
  • FMO 5
  • Hepatic flavin-containing monooxygenase 5

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

FMO3 Antibody
NBP1-33583
Western Blot: FMO3 Antibody [NBP1-33583] - Sample (30 ug of whole cell lysate) A: H1299 7. 5% SDS PAGE; antibody diluted at 1:1000.
Immunocytochemistry/Immunofluorescence: FMO3 Antibody [NBP1-33583] - Analysis of methanol-fixed A431, using antibody at 1:200 dilution.
Immunohistochemistry-Paraffin: FMO3 Antibody [NBP1-33583] - Paraffin-embedded OVCAR3 xenograft, using antibody at 1:100 dilution.
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
FMO1 Antibody
NBP1-86412
Immunohistochemistry: FMO1 Antibody [NBP1-86412] - Staining of human duodenum shows strong cytoplasmic positivity in glandular cells.
(1 Publication)
Species: Hu
Applications: IHC, IHC-P
Flavin containing
monooxygenase 4 Antib ...
NBP1-59353
Western Blot: Flavin containing monooxygenase 4 Antibody [NBP1-59353] - Human Fetal Heart, Antibody Dilution: 1.0 ug/ml.
Western Blot: Flavin containing monooxygenase 4 Antibody [NBP1-59353] - HepG2 cell lysate, concentration 0.2-1 ug/ml.
Western Blot: Flavin containing monooxygenase 4 Antibody [NBP1-59353] - Human Fetal Lung, Antibody Dilution: 1.0 ug/ml.
Species: Hu
Applications: WB
FMO2 Antibody
NBP1-85952
Western Blot: FMO2 Antibody [NBP1-85952] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).
Immunohistochemistry-Paraffin: FMO2 Antibody [NBP1-85952] - Staining of human lung shows moderate cytoplasmic positivity in macrophages.
Immunohistochemistry-Paraffin: FMO2 Antibody [NBP1-85952] - Staining of human liver shows moderate cytoplasmic positivity in hepatocytes.
Species: Hu, Mu
Applications: WB, IHC, IHC-P
Cytochrome P450
3A4 Antibody (3H8)
NBP2-37502
Western Blot: Cytochrome P450 3A4 Antibody (3H8) [NBP2-37502] - Western blot analysis using CYP3A4 mAb against HEK293 (1) and CYP3A4 (AA: 243-430)-hIgGFc transfected HEK293 (2) cell lysate.
Immunocytochemistry/Immunofluorescence: Cytochrome P450 3A4 Antibody (3H8) [NBP2-37502] - Immunofluorescence analysis of HepG2 cells using CYP3A4 mouse mAb (green). Blue: DRAQ5 fluorescent DNA dye. Red: Actin filaments have been labeled with Alexa Fluor-555 phalloidin.
Immunohistochemistry: Cytochrome P450 3A4 Antibody (3H8) [NBP2-37502] - Immunohistochemical analysis of paraffin-embedded human brain tissues using CYP3A4 mouse mAb with DAB staining.
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready
Cytochrome P450
1A2 Antibody (OTI8F1)
NBP2-02563
Western Blot: Cytochrome P450 1A2 Antibody (8F1) [NBP2-02563] - HEK293T cells were transfected with the pCMV6-ENTRY control (Left lane) or pCMV6-ENTRY Cytochrome P450 1A2 (Right lane) cDNA for 48 hrs and lysed. Equivalent amounts of cell lysates (5 ug per lane) were separated by SDS-PAGE and immunoblotted with anti-Cytochrome P450 1A2.
Immunohistochemistry-Paraffin: Cytochrome P450 1A2 Antibody (8F1) [NBP2-02563] - Staining of paraffin-embedded Adenocarcinoma of Human ovary tissue using anti-Cytochrome P450 1A2 mouse monoclonal antibody.
Flow Cytometry: Cytochrome P450 1A2 Antibody (8F1) [NBP2-02563] - HEK293T cells transfected with either overexpression plasmid (Red) or empty vector control plasmid (Blue) were immunostained by anti-Cytochrome P450 1A2 antibody, and then analyzed by flow cytometry.
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Cytochrome P450
2A6 Antibody (OTI1D2)
NBP2-01437
Western Blot: Cytochrome P450 2A6 Antibody (1D2) [NBP2-01437] Analysis of extracts (35ug) from 9 different cell lines by using anti-Cytochrome P450 2A6 monoclonal antibody (HepG2: human; HeLa: human; SVT2: mouse; A549: human; COS7: monkey; Jurkat: human; MDCK: canine; PC12: rat; MCF7: human).
Immunohistochemistry-Paraffin: Cytochrome P450 2A6 Antibody (1D2) [NBP2-01437] - Staining of paraffin-embedded Human prostate tissue using anti-Cytochrome P450 2A6 mouse monoclonal antibody.
Western Blot: Cytochrome P450 2A6 Antibody (1D2) [NBP2-01437] - HEK293T cells were transfected with the pCMV6-ENTRY control (Left lane) or pCMV6-ENTRY Cytochrome P450 2A6 (Right lane) cDNA for 48 hrs and lysed. Equivalent amounts of cell lysates (5 ug per lane) were separated by SDS-PAGE and immunoblotted with anti-Cytochrome P450 2A6.
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, IHC, IHC-P
Cytochrome P450
2D6 Antibody (JM44-23
NBP2-67020
Western Blot: Cytochrome P450 2D6 Antibody (JM44-23) [NBP2-67020] - Analysis of Cytochrome P450 2D6 on HepG2 cell using anti-Cytochrome P450 2D6 antibody at 1/1,000 dilution.
Immunocytochemistry/Immunofluorescence: Cytochrome P450 2D6 Antibody (JM44-23) [NBP2-67020] - Staining Cytochrome P450 2D6 in SW480 cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.
Immunohistochemistry-Paraffin: Cytochrome P450 2D6 Antibody (JM44-23) [NBP2-67020] - Analysis of paraffin-embedded human liver tissue using anti-Cytochrome P450 2D6 antibody. Counter stained with hematoxylin.
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Cytochrome P450
2C19 RNAi
H00001557-R01
Species: Hu
Cytochrome P450
2B6 Antibody (OTI3D5)
NBP2-01800
Western Blot: Cytochrome P450 2B6 Antibody (3D5) [NBP2-01800] - Analysis of extracts (35ug) from 9 different cell lines by using anti-Cytochrome P450 2B6 monoclonal antibody (HepG2: human; HeLa: human; SVT2: mouse; A549: human; COS7: monkey; Jurkat: human; MDCK: canine; PC12: rat; MCF7: human).
Immunocytochemistry/Immunofluorescence: Cytochrome P450 2B6 Antibody (3D5) [NBP2-01800] - Staining of COS7 cells transiently transfected by pCMV6-ENTRY Cytochrome P450 2B6.
Immunohistochemistry-Paraffin: Cytochrome P450 2B6 Antibody (3D5) [NBP2-01800] - Staining of paraffin-embedded Human liver tissue using anti-Cytochrome P450 2B6 mouse monoclonal antibody.
(1 Publication)
Species: Hu, Mu, Rt, Ca, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Cytochrome P450
2E1 Antibody
NBP1-85367
Western Blot: Cytochrome P450 2E1 Antibody [NBP1-85367] - Western blot analysis in mouse liver tissue and rat liver tissue.
Immunohistochemistry-Paraffin: Cytochrome P450 2E1 Antibody [NBP1-85367] - Staining in human liver and endometrium tissues. Corresponding CYP2E1 RNA-seq data are presented for the same tissues.
Western Blot: Cytochrome P450 2E1 Antibody [NBP1-85367] - Analysis in human liver tissue.
(1 Publication)
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
Cytochrome P450
1A1/1A2 Antibody (MC1
NB100-74398
Immunocytochemistry/Immunofluorescence: Cytochrome P450 1A1/1A2 Antibody (MC1) [NB100-74398] - Analysis of Cytochrome P450 1A1/1A2 (green) showing staining in the cytoplasm and membrane of COS-7 cells. Formalin-fixed cells were permeabilized with 0.1% Triton X-100 in TBS for 5-10 minutes and blocked with 3% BSA-PBS for 30 minutes at room temperature. Cells were probed with a Cytochrome P450 1A1/1A2 monoclonal antibody in 3% BSA-PBS at a dilution of 1:100 and incubated overnight at 4C in a humidified chamber. Cells were washed with PBST and incubated with a DyLight-conjugated secondary antibody in PBS at room temperature in the dark. F-actin (red) was stained with a fluorescent red phalloidin and nuclei (blue) were stained with Hoechst or DAPI.
Immunohistochemistry-Paraffin: Cytochrome P450 1A1/1A2 Antibody (MC1) [NB100-74398] - Analysis showing positive staining in the cytoplasm and membrane of Mouse liver tissue (right) compared with a negative control in the absence of primary antibody (left).
Immunocytochemistry/Immunofluorescence: Cytochrome P450 1A1/1A2 Antibody (MC1) [NB100-74398] - Analysis of Cytochrome P450 1A1/1A2 (green) showing staining in the cytoplasm and membrane of HT29 cells. Formalin-fixed cells were permeabilized with 0.1% Triton X-100 in TBS for 5-10 minutes and blocked with 3% BSA-PBS for 30 minutes at room temperature. Cells were probed with a Cytochrome P450 1A1/1A2 monoclonal antibody in 3% BSA-PBS at a dilution of 1:100 and incubated overnight at 4C in a humidified chamber. Cells were washed with PBST and incubated with a DyLight-conjugated secondary antibody in PBS at room temperature in the dark. F-actin (red) was stained with a fluorescentred phalloidin and nuclei (blue) were stained with Hoechst or DAPI.
(1 Review)
(1 Publication)
Species: Hu, Mu, Rt, Pm
Applications: WB, ICC/IF, IHC, IHC-P
Cytochrome P450
2C8 Antibody
NBP1-88054
Western Blot: Cytochrome P450 2C8 Antibody [NBP1-88054] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). Lane 5: Human liver tissue. Lane 6: Human tonsil tissue
Immunohistochemistry-Paraffin: Cytochrome P450 2C8 Antibody [NBP1-88054] - Staining in human liver and pancreas tissues using anti-CYP2C8 antibody. Corresponding CYP2C8 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: Cytochrome P450 2C8 Antibody [NBP1-88054] - Staining of human liver shows high expression.
Species: Hu
Applications: WB, IHC, IHC-P
TGF-beta RI/ALK-5
Antibody [Unconjugate ...
AF3025
Western blot shows lysates of HeLa human cervical epithelial carcinoma cell line, HepG2 human hepatocellular carcinoma cell line, and Raji human Burkitt's lymphoma cell line. PVDF membrane was probed with 0.2 µg/mL of Goat Anti-Human TGF‑ beta  RI/ALK‑5 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF3025) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF019). Specific bands were detected for TGF‑ beta  RI/ALK‑5 at approximately 50 & 56 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
TGF-beta  RI/ALK‑5 was detected in immersion fixed human peripheral blood mononuclear cells (PBMCs) stimulated with LPS and monensin using Goat Anti-Human TGF‑ beta  RI/ALK‑5 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF3025) at 10 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Goat IgG Secondary Antibody (yellow; Catalog # NL001) and counter­stained with DAPI (blue). View our protocol for Fluorescent ICC Staining of Non-adherent Cells.
(4 Publications)
Species: Hu
Applications: WB, ELISA, ICC
ADCY10 Antibody
NBP1-81765
Immunohistochemistry-Paraffin: ADCY10 Antibody [NBP1-81765] - Staining of human kidney shows strong positivity in tubules.
Species: Hu
Applications: IHC, IHC-P
SLC45A2 Antibody
NBP1-59786
Western Blot: SLC45A2 Antibody [NBP1-59786] - Human Fetal Liver, Antibody Dilution: 1.0 ug/ml.
Western Blot: SLC45A2 Antibody [NBP1-59786] - Titration: 0.2-1 ug/ml Positive Control: Jurkat cell lysate.
Western Blot: SLC45A2 Antibody [NBP1-59786] - Human Adult Placenta, Antibody Dilution: 1.0 ug/ml.
Species: Hu
Applications: WB
TLR4 Antibody
(76B357.1)
NB100-56566
Western Blot: TLR4 Antibody (76B357.1) [NB100-56566] - Analysis using 2 ug/ml on (A) human intestine and 6 ug/ml on (B) mouse intestine and C) rat intestine lysate.
Immunohistochemistry-Paraffin: TLR4 Antibody (76B357.1) [NB100-56566] - Human skin stained with at 5 ug/ml, peroxidase-conjugate and DAB chromogen. Staining of formalin-fixed tissues is enhanced by boiling tissue sections in 10 mM sodium citrate buffer, pH 6.0 for 10-20 min followed by cooling at RT for 20 min.
Flow (Intracellular): TLR4 Antibody (76B357.1) [NB100-56566] - Analysis using PE conjugate of NBP2-27149. An intracellular stain was performed on Jurkat cells with TLR4 antibody (76B357.1) NBP2-27149PE (blue) and an isotype control MAB004 (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 2.5 ug/mL for 30 minutes at room temperature. Both antibodies were conjugated to phycoerythrin.
(5 Reviews)
(77 Publications)
Species: Hu, Mu, Rt
Applications: WB, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, CyTOF-ready, ELISA(Cap), Flow-CS, Flow-IC
UGT Antibody
NBP1-80642
Immunocytochemistry/Immunofluorescence: UGT Antibody [NBP1-80642] - Immunofluorescent staining of human cell line A-431 shows localization to the Golgi apparatus. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: UGT Antibody [NBP1-80642] - Staining of human rectum shows strong cytoplasmic staining and additional nuclear membrane positivity in glandular cells.
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Cytochrome P450
2C9 Antibody (OTI1D7)
NBP2-01397
Western Blot: Cytochrome P450 2C9 Antibody (1D7) [NBP2-01397] - HEK293T cells were transfected with the pCMV6-ENTRY control (Left lane) or pCMV6-ENTRY Cytochrome P450 2C9 (Right lane) cDNA for 48 hrs and lysed. Equivalent amounts of cell lysates (5 ug per lane) were separated by SDS-PAGE and immunoblotted with anti-Cytochrome P450 2C9.
Immunocytochemistry/Immunofluorescence: Cytochrome P450 2C9 Antibody (1D7) [NBP2-01397] Staining of COS7 cells transiently transfected by pCMV6-ENTRY Cytochrome P450 2C9.
Immunohistochemistry-Paraffin: Cytochrome P450 2C9 Antibody (1D7) [NBP2-01397] - Staining of paraffin-embedded Human liver tissue using anti-Cytochrome P450 2C9 mouse monoclonal antibody.
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
FMO5 Antibody
NBP1-86093
FMO5 Antibody
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for FMO5 Antibody (NBP1-86093) (0)

There are no publications for FMO5 Antibody (NBP1-86093).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FMO5 Antibody (NBP1-86093) (0)

There are no reviews for FMO5 Antibody (NBP1-86093). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for FMO5 Antibody (NBP1-86093) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for FMO5 Antibody (NBP1-86093)

Discover related pathways, diseases and genes to FMO5 Antibody (NBP1-86093). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for FMO5 Antibody (NBP1-86093)

Discover more about diseases related to FMO5 Antibody (NBP1-86093).
 

Pathways for FMO5 Antibody (NBP1-86093)

View related products by pathway.

PTMs for FMO5 Antibody (NBP1-86093)

Learn more about PTMs related to FMO5 Antibody (NBP1-86093).
 

Research Areas for FMO5 Antibody (NBP1-86093)

Find related products by research area.

Blogs on FMO5

There are no specific blogs for FMO5, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our FMO5 Antibody and receive a gift card or discount.


Bioinformatics

Gene Symbol FMO5