FMO5 Antibody - BSA Free

Immunohistochemistry-Paraffin: FMO5 Antibody [NBP1-86093] - Staining in human liver and cerebral cortex tissues using anti-FMO5 antibody. Corresponding FMO5 RNA-seq data are presented for the same tissues.

Immunocytochemistry/Immunofluorescence: FMO5 Antibody [NBP1-86093] - Immunofluorescent staining of human cell line A-431 shows localization to endoplasmic reticulum.

Immunohistochemistry-Paraffin: FMO5 Antibody [NBP1-86093] - Staining of human liver shows high expression.

Immunohistochemistry-Paraffin: FMO5 Antibody [NBP1-86093] - Staining of human cerebral cortex shows low expression as expected.

• Reactivity: Hu
• Applications: ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

FMO5 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: PLGAIMPISELQGRWATQVFKGLKTLPSQSEMMAEISKAQEEIDKRYVESQRHTIQGDYIDTMEELADLVGVRPNLLSLAFTDPKLALHLLLGPCTPIHYRVQGPGKWDGARKAILTTDD
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: FMO5
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  FMO5 Protein (NBP1-86093PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (85%), Rat (86%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for FMO5 Antibody - BSA Free

• dimethylaniline monooxygenase [N-oxide-forming] 5
• Dimethylaniline oxidase 5
• EC 1.14.13.8
• flavin containing monooxygenase 5
• FMO 5
• Hepatic flavin-containing monooxygenase 5

Background

FMO5, also known as Dimethylaniline monooxygenase [N-oxide-forming] 5, has a 533 amino acid long isoform that is 60 kDa and a short 285 amino acid isoform that is 32 kDa; is most often expressed in adult and fetal liver, and in contrast with other forms of FMO it does not seem to be a drug-metabolizing enzyme. This protein has been studied for its involvement in trimethylaminuria, hearing loss, hepatitis, and atrioventricular septal defect. FMO5 interacts with CYP3A5, CYP3A43, CYP2D6, CYP3A7, and CYP3A4 and it has been linked to Busulfan Q06828 (pharmacodynamics) and drug metabolism - cytochrome P450 pathways .

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for FMO5 Antibody (NBP1-86093)(1)

Publication using NBP1-86093

• Zhao RC, Wang J, Dong H, Li Z Flavin-Containing Dimethylaniline Monooxygenase 5 Drives Malignancies in Hepatocellular Carcinoma by Blocking IQGAP1 Ubiquitination via Increasing its SUMOylation School of Life Sciences, Shanghai University, China 2023-01-01

Bioinformatics

• Gene Symbol: FMO5