Cytochrome P450 3A5 Antibody

Images

 
Western Blot: Cytochrome P450 3A5 Antibody [NBP1-68885] - Titration: 0.2-1 ug/ml, Positive Control: Human Placenta.
Immunohistochemistry: Cytochrome P450 3A5 Antibody [NBP1-68885] - Human Adult Small intestine Observed Staining: Cytoplasm in hepatocytes Primary Antibody Concentration: 1 : 600 Secondary Antibody: Donkey ...read more

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Cytochrome P450 3A5 Antibody Summary

Immunogen
Synthetic peptides corresponding to CYP3A5 (cytochrome P450, family 3, subfamily A, polypeptide 5) The peptide sequence was selected from the N terminal of CYP3A5. Peptide sequence AITDPDVIRTVLVKECYSVFTNRRSLGPVGFMKSAISLAEDEEWKRIRSL.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CYP3A5
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
  • Immunohistochemistry
Application Notes
This is a rabbit polyclonal antibody against CYP3A5 and was validated on Western blot.
Theoretical MW
57 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for Cytochrome P450 3A5 Antibody

  • aryl hydrocarbon hydroxylase
  • CP35
  • CYPIIIA5
  • cytochrome P450 3A5
  • Cytochrome P450 HLp2
  • cytochrome P-450
  • cytochrome P450, family 3, subfamily A, polypeptide 5
  • cytochrome P450, subfamily IIIA (niphedipine oxidase), polypeptide 5
  • Cytochrome P450-PCN3
  • DKFZp686L16231
  • EC 1.14.14.1
  • flavoprotein-linked monooxygenase
  • microsomal monooxygenase
  • niphedipine oxidase
  • P450PCN3FLJ31317
  • PCN3
  • xenobiotic monooxygenase

Background

This gene,CYP3A5, encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This protein localizes to the endoplasmic reticulum and its expression is induced by glucocorticoids and some pharmacological agents. The enzyme metabolizes drugs such as nifedipine and cyclosporine as well as the steroid hormones testosterone, progesterone and androstenedione. This gene is part of a cluster of cytochrome P450 genes on chromosome 7q21.1. This cluster includes a pseudogene, CYP3A5P1, which is very similar to CYP3A5. This similarity has caused some difficulty in determining whether cloned sequences represent the gene or the pseudogene. Multiple alternatively spliced transcript variants have been identified for this gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-37502
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready
NB100-74398
Species: Hu, Mu, Rt, Pm
Applications: WB, ICC/IF, IHC, IHC-P
H00057491-R01
Species: Hu
NBP2-46466
Species: Hu
Applications: IHC
NBP1-85488
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-01397
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-91818
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-02563
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-01800
Species: Hu, Mu, Rt, Ca, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB100-128
Species: Hu, Mu, Rt
Applications: ChIP, GS, ICC/IF, IHC, IHC-P
H00001551-B01P
Species: Hu
Applications: WB
NBP2-13415
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-01437
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, IHC, IHC-P
NBP2-16078
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-85367
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
PP-H4417-00
Species: Hu
Applications: WB, IP, DirELISA
MAB1106
Species: Hu
Applications: WB, ELISA(Cap), ELISA(Det), ELISA(Sta)
H00003347-M01
Species: Hu
Applications: ELISA, ICC/IF

Publications for Cytochrome P450 3A5 Antibody (NBP1-68885) (0)

There are no publications for Cytochrome P450 3A5 Antibody (NBP1-68885).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Cytochrome P450 3A5 Antibody (NBP1-68885) (0)

There are no reviews for Cytochrome P450 3A5 Antibody (NBP1-68885). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Cytochrome P450 3A5 Antibody (NBP1-68885) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Cytochrome P450 3A5 Products

Bioinformatics Tool for Cytochrome P450 3A5 Antibody (NBP1-68885)

Discover related pathways, diseases and genes to Cytochrome P450 3A5 Antibody (NBP1-68885). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Cytochrome P450 3A5 Antibody (NBP1-68885)

Discover more about diseases related to Cytochrome P450 3A5 Antibody (NBP1-68885).
 

Pathways for Cytochrome P450 3A5 Antibody (NBP1-68885)

View related products by pathway.

PTMs for Cytochrome P450 3A5 Antibody (NBP1-68885)

Learn more about PTMs related to Cytochrome P450 3A5 Antibody (NBP1-68885).
 

Research Areas for Cytochrome P450 3A5 Antibody (NBP1-68885)

Find related products by research area.

Blogs on Cytochrome P450 3A5

There are no specific blogs for Cytochrome P450 3A5, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Cytochrome P450 3A5 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CYP3A5
Uniprot