Cytochrome P450 2C19 Antibody


Western Blot: Cytochrome P450 2C19 Antibody [NBP3-10546] - Western blot analysis using NBP3-10546 on Human Placenta as a positive control. Antibody Titration: 0.2-1 ug/ml

Product Details

Reactivity HuSpecies Glossary
Applications WB

Order Details

Cytochrome P450 2C19 Antibody Summary

The immunogen is a synthetic peptide directed towards the middle region of human Cytochrome P450 2C19 (NP_000760). Peptide sequence QEEIERVIGRNRSPCMQDRGHMPYTDAVVHEVQRYIDLIPTSLPHAVTCD
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1.0 ug/ml
Theoretical MW
56 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS buffer, 2% sucrose.
0.09% Sodium Azide
Affinity purified

Alternate Names for Cytochrome P450 2C19 Antibody

  • (R)-limonene 6-monooxygenase
  • (S)-limonene 6-monooxygenase
  • (S)-limonene 7-monooxygenase
  • CPCJ
  • CYP2C
  • CYP2C19
  • CYPIIC17
  • CYPIIC19
  • Cytochrome P450 2C19
  • cytochrome P-450 II C
  • cytochrome P450, family 2, subfamily C, polypeptide 19
  • cytochrome P450, subfamily IIC (mephenytoin 4-hydroxylase), polypeptide 19
  • Cytochrome P450-11A
  • Cytochrome P450-254C
  • EC
  • EC
  • EC
  • EC
  • EC
  • EC
  • EC
  • EC
  • flavoprotein-linked monooxygenase
  • mephenytoin 4'-hydroxylase
  • Mephenytoin 4-hydroxylase
  • microsomal monooxygenase
  • P450C2C
  • P450IIC19
  • S-mephenytoin 4-hydroxylase
  • xenobiotic monooxygenase


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, Simple Western, WB
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt, V-Vi
Applications: IHC, IHC-P, WB
Species: Ca, Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu, Pm, Mu, Pm, Rt
Applications: Flow, IHC, IHC-P, WB
Species: Hu, Mu, Pm, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ELISA, IHC, WB
Species: Hu
Applications: WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Hu, Mu, Rt
Applications: WB
Species: Hu
Applications: DirELISA, IP, WB
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
Species: Hu, Pm, Mu, Po, Pm, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, WB
Species: Hu
Applications: IHC, IHC-P, In vitro, WB
Species: Hu
Applications: IHC, IP, WB
Species: Hu
Applications: CyTOF-ready, IP, ICFlow, WB
Species: Hu
Applications: WB

Publications for Cytochrome P450 2C19 Antibody (NBP3-10546) (0)

There are no publications for Cytochrome P450 2C19 Antibody (NBP3-10546).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Cytochrome P450 2C19 Antibody (NBP3-10546) (0)

There are no reviews for Cytochrome P450 2C19 Antibody (NBP3-10546). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Cytochrome P450 2C19 Antibody (NBP3-10546) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Cytochrome P450 2C19 Products

Bioinformatics Tool for Cytochrome P450 2C19 Antibody (NBP3-10546)

Discover related pathways, diseases and genes to Cytochrome P450 2C19 Antibody (NBP3-10546). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Cytochrome P450 2C19 Antibody (NBP3-10546)

Discover more about diseases related to Cytochrome P450 2C19 Antibody (NBP3-10546).

Pathways for Cytochrome P450 2C19 Antibody (NBP3-10546)

View related products by pathway.

PTMs for Cytochrome P450 2C19 Antibody (NBP3-10546)

Learn more about PTMs related to Cytochrome P450 2C19 Antibody (NBP3-10546).

Research Areas for Cytochrome P450 2C19 Antibody (NBP3-10546)

Find related products by research area.

Blogs on Cytochrome P450 2C19

There are no specific blogs for Cytochrome P450 2C19, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our Cytochrome P450 2C19 Antibody and receive a gift card or discount.


Gene Symbol CYP2C19