Cytochrome P450 2C8 Antibody

Images

 
Western Blot: Cytochrome P450 2C8 Antibody [NBP1-88054] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA ...read more
Immunohistochemistry-Paraffin: Cytochrome P450 2C8 Antibody [NBP1-88054] - Staining of human liver shows strong cytoplasmic positivity in hepatocytes.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Cytochrome P450 2C8 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:ICSVVFQKRFDYKDQNFLTLMKRFNENFRILNSPWIQVCNNFPLLIDCFPGTHNKVLKNVALTRSYIREKVKEHQASLDVNNPRDFIDCFLIKMEQEKDNQKSEFNIENLVGTVADLFVAG
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CYP2C8
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Cytochrome P450 2C8 Protein (NBP1-88054PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Cytochrome P450 2C8 Antibody

  • CPC8
  • CYPIIC8
  • cytochrome P450 2C8
  • Cytochrome P450 form 1
  • Cytochrome P450 IIC2
  • Cytochrome P450 MP-12
  • Cytochrome P450 MP-20
  • cytochrome P450, family 2, subfamily C, polypeptide 8
  • cytochrome P450, subfamily IIC (mephenytoin 4-hydroxylase), polypeptide 8
  • EC 1.14.14.1
  • flavoprotein-linked monooxygenase
  • microsomal monooxygenase
  • MP-12/MP-20
  • P450 form 1
  • S-mephenytoin 4-hydroxylase
  • xenobiotic monooxygenase

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-37502
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready
NBP2-01397
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-85488
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-02563
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-91818
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-85367
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-01800
Species: Hu, Mu, Rt, Ca, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-01437
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, IHC, IHC-P
NB100-74398
Species: Hu, Mu, Rt, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-29917
Species: Hu
Applications: WB, ICC/IF, IHC-P
NB600-1032
Species: Hu, Mu, Rt, Ba
Applications: WB, ICC/IF, IHC
NBP2-46466
Species: Hu
Applications: IHC
NBP2-24722
Species: Hu
Applications: WB, IHC-P
PP-H4417-00
Species: Hu
Applications: WB, IP, DirELISA
H00001551-B01P
Species: Hu
Applications: WB
NBP2-01286
Species: Hu
Applications: WB, IHC, IHC-P
NB100-74482
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
PP-N4111-00
Species: Hu
Applications: WB, IHC, IP
MAB1106
Species: Hu
Applications: WB, ELISA(Cap), ELISA(Det), ELISA(Sta)

Publications for Cytochrome P450 2C8 Antibody (NBP1-88054) (0)

There are no publications for Cytochrome P450 2C8 Antibody (NBP1-88054).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Cytochrome P450 2C8 Antibody (NBP1-88054) (0)

There are no reviews for Cytochrome P450 2C8 Antibody (NBP1-88054). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Cytochrome P450 2C8 Antibody (NBP1-88054) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Cytochrome P450 2C8 Products

Bioinformatics Tool for Cytochrome P450 2C8 Antibody (NBP1-88054)

Discover related pathways, diseases and genes to Cytochrome P450 2C8 Antibody (NBP1-88054). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Cytochrome P450 2C8 Antibody (NBP1-88054)

Discover more about diseases related to Cytochrome P450 2C8 Antibody (NBP1-88054).
 

Pathways for Cytochrome P450 2C8 Antibody (NBP1-88054)

View related products by pathway.

PTMs for Cytochrome P450 2C8 Antibody (NBP1-88054)

Learn more about PTMs related to Cytochrome P450 2C8 Antibody (NBP1-88054).
 

Research Areas for Cytochrome P450 2C8 Antibody (NBP1-88054)

Find related products by research area.

Blogs on Cytochrome P450 2C8

There are no specific blogs for Cytochrome P450 2C8, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Cytochrome P450 2C8 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CYP2C8