Flightless I Antibody

Images

 
Western Blot: Flightless I Antibody [NBP1-87926] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
Immunocytochemistry/ Immunofluorescence: Flightless I Antibody [NBP1-87926] - Staining of human cell line U-2 OS shows localization to nucleoplasm, cytosol & microtubule organizing center.
Immunohistochemistry-Paraffin: Flightless I Antibody [NBP1-87926] - Staining of human skeletal muscle shows strong cytoplasmic positivity in myocytes.
Western Blot: Flightless I Antibody [NBP1-87926] - Analysis in human cell line A-549.
Immunocytochemistry/ Immunofluorescence: Flightless I Antibody [NBP1-87926] - Staining of human cell line U-2 OS shows positivity in cytoplasm, microtubule organizing center and nucleus but excluded from the nucleoli.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Flightless I Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: KDSAQDDQAKQVLKGMSDVAQEKNKKQEESADARAPSGKVRRWDQGLEKPRLDYSEFFTEDVGQLPGLTIWQIENFVPVLVEEAFHGKFYEADCYIVLKTFLDDSGSLNWEIYYWIGGEATLDKKACSAI
Specificity
Specificity of human, mouse, rat Flightless I antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
FLII
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: PFA/Triton X-100
Positive Control
Flightless I Lysate (NBP2-66146)
Control Peptide
Flightless I Protein (NBP1-87926PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Flightless I Antibody

  • FLI
  • Fli1
  • flightless I homolog (Drosophila)
  • FLILflightless I (Drosophila) homolog
  • MGC39265
  • protein flightless-1 homolog

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-16389
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB110-75039
Species: Hu, Mu, Rt, Pm
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-60655
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00003757-Q01
Species: Hu
NBP2-67019
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NB100-56620
Species: Hu
Applications: WB
NBP2-01488
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
NBP1-47492
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Flow-IC
NBP1-84550
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-27163
Species: Hu, Mu, Bv, Ca, Eq, Pm
Applications: WB, Flow
NBP2-34294
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC, IHC-P
NBP1-33177
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-48693
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88080
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-P
NBP2-57731
Species: Hu
Applications: WB, ICC/IF
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE

Publications for Flightless I Antibody (NBP1-87926) (0)

There are no publications for Flightless I Antibody (NBP1-87926).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Flightless I Antibody (NBP1-87926) (0)

There are no reviews for Flightless I Antibody (NBP1-87926). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Flightless I Antibody (NBP1-87926) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Positive Control Lysate(s)

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for Flightless I Antibody (NBP1-87926)

Discover related pathways, diseases and genes to Flightless I Antibody (NBP1-87926). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Flightless I Antibody (NBP1-87926)

Discover more about diseases related to Flightless I Antibody (NBP1-87926).
 

Pathways for Flightless I Antibody (NBP1-87926)

View related products by pathway.

PTMs for Flightless I Antibody (NBP1-87926)

Learn more about PTMs related to Flightless I Antibody (NBP1-87926).

Blogs on Flightless I

There are no specific blogs for Flightless I, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Flightless I Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol FLII