![Immunocytochemistry/Immunofluorescence: Flightless I Antibody [NBP1-87926] - Staining of human cell line U-2 OS shows localization to nucleoplasm, cytosol & microtubule organizing center.](http://images.novusbio.com/fullsize/Flightless-I-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-87926-img0010.jpg "Immunocytochemistry/Immunofluorescence: Flightless I Antibody [NBP1-87926] - Staining of human cell line U-2 OS shows localization to nucleoplasm, cytosol & microtubule organizing center.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | BSA Free |
| Description | Novus Biologicals Rabbit Flightless I Antibody - BSA Free (NBP1-87926) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: KDSAQDDQAKQVLKGMSDVAQEKNKKQEESADARAPSGKVRRWDQGLEKPRLDYSEFFTEDVGQLPGLTIWQIENFVPVLVEEAFHGKFYEADCYIVLKTFLDDSGSLNWEIYYWIGGEATLDKKACSAI |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | FLII |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: PFA/Triton X-100 |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
![Western Blot Ets-1 Antibody [Unconjugated]](https://images.novusbio.com/images2/Ets-1_AF7284_Western_Blot_11854.jpg)
![Immunohistochemistry Ets-1 Antibody [Unconjugated]](https://images.novusbio.com/images2/Ets1_AF7284_Immunohistochemistry_22698.jpg)
Secondary Antibodies |
Isotype Controls |
Research Areas for Flightless I Antibody (NBP1-87926)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | FLII |
![Immunohistochemistry-Paraffin: Flightless I Antibody [NBP1-87926] - Staining of human testis shows strong cytoplasmic positivity in cells in seminiferous ducts.](http://images.novusbio.com/fullsize/Flightless-I-Antibody-Immunohistochemistry-Paraffin-NBP1-87926-img0014.jpg "Immunohistochemistry-Paraffin: Flightless I Antibody [NBP1-87926] - Staining of human testis shows strong cytoplasmic positivity in cells in seminiferous ducts.")
![Immunohistochemistry-Paraffin: Flightless I Antibody [NBP1-87926] - Staining of human cerebral cortex shows moderate cytoplasmic positivity in neurons.](http://images.novusbio.com/fullsize/Flightless-I-Antibody-Immunohistochemistry-Paraffin-NBP1-87926-img0011.jpg "Immunohistochemistry-Paraffin: Flightless I Antibody [NBP1-87926] - Staining of human cerebral cortex shows moderate cytoplasmic positivity in neurons.")
![Immunohistochemistry-Paraffin: Flightless I Antibody [NBP1-87926] - Staining of human gastrointestinal shows strong cytoplasmic positivity in glandular cells.](http://images.novusbio.com/fullsize/Flightless-I-Antibody-Immunohistochemistry-Paraffin-NBP1-87926-img0012.jpg "Immunohistochemistry-Paraffin: Flightless I Antibody [NBP1-87926] - Staining of human gastrointestinal shows strong cytoplasmic positivity in glandular cells.")
![Immunohistochemistry-Paraffin: Flightless I Antibody [NBP1-87926] - Staining of human skeletal muscle shows strong cytoplasmic positivity in myocytes.](http://images.novusbio.com/fullsize/Flightless-I-Antibody-Immunohistochemistry-Paraffin-NBP1-87926-img0013.jpg "Immunohistochemistry-Paraffin: Flightless I Antibody [NBP1-87926] - Staining of human skeletal muscle shows strong cytoplasmic positivity in myocytes.")
![Western Blot: Flightless I Antibody [NBP1-87926] - Analysis in human cell line A-549.](http://images.novusbio.com/fullsize/Flightless-I-Antibody-Western-Blot-NBP1-87926-img0006.jpg "Western Blot: Flightless I Antibody [NBP1-87926] - Analysis in human cell line A-549.")
![Flow Cytometry CD99 Antibody [Unconjugated]](https://images.novusbio.com/images2/CD99_AF3968_Flow_Cytometry_8220.jpg)
![Western Blot CD99 Antibody [Unconjugated]](https://images.novusbio.com/images2/CD99_AF3968_Western_Blot_23993.jpg)
![Simple Western CD99 Antibody [Unconjugated]](https://images.novusbio.com/images2/CD99_AF3968_Simple_Western_24089.jpg)
![Bioactivity CTLA-4 [Unconjugated]](https://images.novusbio.com/images2/CTLA4_7268CT_2293.jpg)
![Simple Western Gelsolin/GSN Antibody (893205) [Unconjugated]](https://images.novusbio.com/images2/Gelsolin_MAB8170_Simple_Western_17259.jpg)
![Western Blot Gelsolin/GSN Antibody (893205) [Unconjugated]](https://images.novusbio.com/images2/Gelsolin_MAB8170_Western_Blot_14481.jpg)
![Immunohistochemistry Gelsolin/GSN Antibody (893205) [Unconjugated]](https://images.novusbio.com/images2/Gelsolin_MAB8170_Immunohistochemistry_14553.jpg)
![N/A VEGF [HRP]](https://images.novusbio.com/images2/DATA_VEGF_DVE00_ELISA_871.jpg)
![N/A VEGF [HRP]](https://images.novusbio.com/images2/DATA_VEGF_DVE00_ELISA_872.jpg)
![N/A VEGF [HRP]](https://images.novusbio.com/images2/VEGF_DVE00_ELISA_208.jpg)
![Immunocytochemistry Insulin Antibody (182410) [Unconjugated]](https://images.novusbio.com/images2/Insulin_MAB1417_Immunocytochemistry_9376.jpg)
![Immunohistochemistry Insulin Antibody (182410) [Unconjugated]](https://images.novusbio.com/images2/mab1417_human-bovine-mouse-insulin-mab-clone-182410-immunohistochemistry-308202115145.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")