ETV1 Antibody

Images

 
Western Blot: ETV1 Antibody [NBP2-57731] - Analysis in human cell line RT-4, human cell line U-251 MG, human plasma, human liver tissue and human tonsil tissue.
Immunocytochemistry/ Immunofluorescence: ETV1 Antibody [NBP2-57731] - Staining of human cell line PC-3 shows localization to nucleoplasm. Antibody staining is shown in green.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ETV1 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: ASQSFPPPLMIKQEPRDFAYDSEVPSCHSIYMRQEGFLAHPSRTEGCMFEKGPRQFYDDTCVVPE
Specificity
Specificity of human ETV1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (100%), Rat (98%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ETV1
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.04-0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Application Notes
ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
ETV1 Recombinant Protein Antigen (NBP2-57731PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for ETV1 Antibody

  • DKFZp781L0674
  • ER81
  • ER81ets variant gene 1
  • ETS translocation variant 1
  • ets variant 1
  • Ets-related protein 81
  • ETV1
  • MGC104699
  • MGC120533
  • MGC120534

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-87960
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-67375
Species: Hu, Mu, Rt
Applications: WB, ChIP, ICC/IF, IHC, IHC-P
NBP2-80513
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-14950
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-38263
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-92686
Species: Hu, Mu, Rt, Ca, Eq
Applications: WB, ICC/IF, IHC
AF7284
Species: Hu, Mu, Rt
Applications: WB, IHC
NB100-74510
Species: Hu, Mu, Rt, Pm
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NB100-56603
Species: Hu, Mu, Pm
Applications: WB, IHC, IHC-P
NBP1-87926
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-16500
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB110-40415
Species: Hu, Mu, Rt
Applications: WB, IHC, IP
DMP700
Species: Hu
NBP2-83265
Species: Hu
Applications: WB
MAB6860
Species: Hu
Applications: WB, IP
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
H00054738-Q01
Species: Hu
NBP2-67360
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
AF1837
Species: Hu
Applications: WB, Simple Western, ICC

Publications for ETV1 Antibody (NBP2-57731) (0)

There are no publications for ETV1 Antibody (NBP2-57731).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ETV1 Antibody (NBP2-57731) (0)

There are no reviews for ETV1 Antibody (NBP2-57731). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for ETV1 Antibody (NBP2-57731) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional ETV1 Products

Bioinformatics Tool for ETV1 Antibody (NBP2-57731)

Discover related pathways, diseases and genes to ETV1 Antibody (NBP2-57731). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ETV1 Antibody (NBP2-57731)

Discover more about diseases related to ETV1 Antibody (NBP2-57731).
 

Pathways for ETV1 Antibody (NBP2-57731)

View related products by pathway.

PTMs for ETV1 Antibody (NBP2-57731)

Learn more about PTMs related to ETV1 Antibody (NBP2-57731).
 

Research Areas for ETV1 Antibody (NBP2-57731)

Find related products by research area.

Blogs on ETV1

There are no specific blogs for ETV1, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ETV1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ETV1