FKBP52/FKBP4 Antibody

Images

 
Western Blot: FKBP52/FKBP4 Antibody [NBP1-84675] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
Immunocytochemistry/ Immunofluorescence: FKBP52/FKBP4 Antibody [NBP1-84675] - Staining of human cell line U-2 OS shows localization to nucleoplasm & cytosol. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: FKBP52/FKBP4 Antibody [NBP1-84675] - Staining of human testis shows moderate nuclear positivity in cells in seminiferus ducts.
Western Blot: FKBP52/FKBP4 Antibody [NBP1-84675] - Analysis in human cell line HEK 293.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

FKBP52/FKBP4 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:IATMKVGEVCHITCKPEYAYGSAGSPPKIPPNATLVFEVELFEFKGEDLTEEEDGGIIRRIQTRGEGYAKPNEGAIVEVALEGYYKDKLFDQRELRFEIGEGENLDLPYGLERAIQRMEKGE
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
FKBP4
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:1000-1:2500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
FKBP52/FKBP4 Protein (NBP1-84675PEP)
Publications
Read Publication using NBP1-84675.

Reactivity Notes

Reactivity reported in scientific literature (PMID: 23443080)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for FKBP52/FKBP4 Antibody

  • 51 kDa FK506-binding protein
  • 52 kDa FKBP
  • 59 kDa immunophilin
  • EC 5.2.1.8
  • FK506 binding protein 4, 59kDa
  • FK506-binding protein 4 (59kD)
  • FK506-binding protein 4
  • FKBP4
  • FKBP-4
  • FKBP51
  • FKBP52
  • FKBP-52
  • FKBP52T-cell FK506-binding protein, 59kD
  • FKBP59
  • FKBP5952 kDa FK506-binding protein
  • HBI
  • HSP binding immunophilin
  • Hsp56
  • HSP-binding immunophilin
  • Immunophilin FKBP52
  • p52
  • p59
  • peptidyl-prolyl cis-trans isomerase FKBP4
  • peptidylprolyl cis-trans isomerase
  • PPIase FKBP4
  • PPIase
  • rotamase

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-29323
Species: Hu, Mu, Rt, Bv, Ca, Ch, Xp
DDX0131P-100
Species: Hu
Applications: Flow, Func, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-88650
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-01345
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
AF2699
Species: Hu, Mu
Applications: WB, Simple Western, ChIP, ICC
NBP1-91499
Species: Mu, Bv
Applications: WB, ICC/IF, IHC
NB600-225
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
NBP2-02665
Species: Hu, Rt, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-13883
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NB120-2928
Species: Hu, Mu, Rt, Pm, Rb, Sh
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-47974
Species: Hu, Rt, Ca, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NB100-74648
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-85841
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB500-179
Species: Hu, Mu, Rt, Po, Ma
Applications: WB, Simple Western, Flow, ICC/IF, IP
NBP1-88815
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB300-731
Species: Hu, Mu, Rt, GP, Rb, Sh, Ye
Applications: WB, ChIP, B/N, Flow, GS, ICC/IF, IHC, IHC-P, IP
NB120-3562
Species: Hu, Mu, Rt, Bv, Ch, Pm, Rb
Applications: WB, Flow, GS, ICC/IF, IHC, IHC-Fr, IHC-P, IP

Publications for FKBP52/FKBP4 Antibody (NBP1-84675)(1)

Reviews for FKBP52/FKBP4 Antibody (NBP1-84675) (0)

There are no reviews for FKBP52/FKBP4 Antibody (NBP1-84675). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for FKBP52/FKBP4 Antibody (NBP1-84675) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional FKBP52/FKBP4 Products

Bioinformatics Tool for FKBP52/FKBP4 Antibody (NBP1-84675)

Discover related pathways, diseases and genes to FKBP52/FKBP4 Antibody (NBP1-84675). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for FKBP52/FKBP4 Antibody (NBP1-84675)

Discover more about diseases related to FKBP52/FKBP4 Antibody (NBP1-84675).
 

Pathways for FKBP52/FKBP4 Antibody (NBP1-84675)

View related products by pathway.

PTMs for FKBP52/FKBP4 Antibody (NBP1-84675)

Learn more about PTMs related to FKBP52/FKBP4 Antibody (NBP1-84675).
 

Research Areas for FKBP52/FKBP4 Antibody (NBP1-84675)

Find related products by research area.

Blogs on FKBP52/FKBP4

There are no specific blogs for FKBP52/FKBP4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our FKBP52/FKBP4 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol FKBP4
Entrez