Ficolin-3 Antibody

Images

 
Western Blot: Ficolin-3 Antibody [H00008547-D01P] - Analysis of FCN3 expression in transfected 293T cell line by FCN3 polyclonal antibody.Lane 1: FCN3 transfected lysate(31.70 KDa).Lane 2: Non-transfected lysate.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Ficolin-3 Antibody Summary

Immunogen
FCN3 (AAH20731.1, 1 a.a. - 288 a.a.) full-length human protein. MDLLWILPSLWLLLLGGPACLKTQEHPSCPGPRELEASKVVLLPSCPGAPGSPGEKGAPGPQGPPGPPGKMGPKGEPGPRNCRELLSQGATLSGWYHLCLPEGRALPVFCDMDTEGGGWLVFQRRQDGSVDFFRSWSSYRAGFGNQESEFWLGNENLHQLTLQGNWELRVELEDFNGNRTFAHYATFRLLGEVDHYQLALGKFSEGTAGDSLSLHSGRPFTTYDADHDSSNSNCAVIVHGAWWYASCYRSNLNGRYAVSEAAAHKYGIDWASGRGVGHPYRRVRMMLR
Specificity
Reacts with ficolin (collagen/fibrinogen domain containing) 3 (Hakata antigen).
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
FCN3
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
Application Notes
This antibody is reactive against transfected lysate in WB and as a detection antibody in ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein A purified

Notes

Quality control test: Antibody reactive against mammalian transfected lysate.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Ficolin-3 Antibody

  • Collagen/fibrinogen domain-containing lectin 3 p35
  • Collagen/fibrinogen domain-containing protein 3
  • FCNHficolin 3
  • ficolin (collagen/fibrinogen domain containing) 3 (Hakata antigen)
  • ficolin (collagen/fibrinogen domain-containing) 3 (Hakata antigen)
  • ficolin-3
  • HAKA1MGC22543
  • Hakata antigen
  • H-ficolin

Background

Ficolins are a group of proteins which consist of a collagen-like domain and a fibrinogen-like domain. In human serum, there are two types of ficolins, both of which have lectin activity. The protein encoded by this gene is a thermolabile beta-2-macroglycoprotein found in all human serum and is a member of the ficolin/opsonin p35 lectin family. The protein, which was initially identified based on its reactivity with sera from patients with systemic lupus erythematosus, has been shown to have a calcium-independent lectin activity. The protein can activate the complement pathway in association with MASPs and sMAP, thereby aiding in host defense through the activation of the lectin pathway. Alternative splicing occurs at this locus and two variants, each encoding a distinct isoform, have been identified. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF2428
Species: Hu
Applications: WB
NBP1-22568
Species: Hu
Applications: IHC-P
NBP1-81259
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-84705
Species: Hu
Applications: WB, IHC, IHC-P
AF1724
Species: Hu
Applications: WB, IP
NB200-540
Species: Mu
Applications: WB, Flow, IA, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP2-34234
Species: Hu
Applications: ICC/IF, IHC-Fr, IHC-P
NBP1-79075
Species: Hu
Applications: IHC, IHC-P
NBP1-89530
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF3770
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC
NB100-79781
Species: Hu
Applications: WB, IHC, IHC-P, IP
NBP1-92564
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-91931
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
MAB7357
Species: Hu
Applications: WB
NBP2-74988
Species: Rt
NB600-41532
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
MAB1936
Species: Hu
Applications: WB, IP

Publications for Ficolin-3 Antibody (H00008547-D01P) (0)

There are no publications for Ficolin-3 Antibody (H00008547-D01P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Ficolin-3 Antibody (H00008547-D01P) (0)

There are no reviews for Ficolin-3 Antibody (H00008547-D01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Ficolin-3 Antibody (H00008547-D01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for Ficolin-3 Antibody (H00008547-D01P)

Discover related pathways, diseases and genes to Ficolin-3 Antibody (H00008547-D01P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Ficolin-3 Antibody (H00008547-D01P)

Discover more about diseases related to Ficolin-3 Antibody (H00008547-D01P).
 

Pathways for Ficolin-3 Antibody (H00008547-D01P)

View related products by pathway.

PTMs for Ficolin-3 Antibody (H00008547-D01P)

Learn more about PTMs related to Ficolin-3 Antibody (H00008547-D01P).

Blogs on Ficolin-3

There are no specific blogs for Ficolin-3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Ficolin-3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol FCN3
Entrez
Uniprot