Ficolin-1 Antibody - BSA Free

Immunohistochemistry-Paraffin: Ficolin-1 Antibody [NBP1-84705] - Analysis in human bone marrow and pancreas tissues using NBP1-84705 antibody. Corresponding Ficolin-1 RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: Ficolin-1 Antibody [NBP1-84705] - Staining of human bone marrow shows strong cytoplasmic positivity in hematopoietic cells.

Immunohistochemistry-Paraffin: Ficolin-1 Antibody [NBP1-84705] - Staining of human lymph node shows strong cytoplasmic positivity in non-germinal center cells.

Immunohistochemistry-Paraffin: Ficolin-1 Antibody [NBP1-84705] - Staining of human small intestine shows strong cytoplasmic positivity in lymphoid cells.

Immunohistochemistry-Paraffin: Ficolin-1 Antibody [NBP1-84705] - Staining of human pancreas shows no positivity in exocrine glandular cells as expected.

Staining of human bone marrow, gastrointestinal, lymphoid tissues and pancreas using NBP1-84705 (A) shows similar protein distribution across tissues to independent antibody NBP1-84706 (B).

Analysis in control (vector only transfected HEK293T lysate) and FCN1 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY400731).

• Reactivity: Hu
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Ficolin-1 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: QGSSELRVDLVDFEGNHQFAKYKSFKVADEAEKYKLVLGAFVGGSAGNSLTGHNNNFFSTKDQDNDVSSSNCAEKFQGAWWYADCHASNLNGLYLMGPHESYANGINWS
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: FCN1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  Ficolin-1 Protein (NBP1-84705PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for Ficolin-1 Antibody - BSA Free

• Collagen/fibrinogen domain-containing protein 1
• FCN1
• Fcna
• FCNM
• FCNMficolin-A
• ficolin (collagen/fibrinogen domain containing) 1
• ficolin (collagen/fibrinogen domain-containing) 1
• Ficolin1
• Ficolin-1
• Ficolin-A
• ficolin-alpha
• M-ficolin

Background

M-Ficolin (Ficolin-1) is a non-serum protein that is expressed in leukocytes and lung. M-Ficolin precipitates with mannose-binding lectin (MBL)-associated serine proteases (MASP)-1 and MASP-2, indicating that M-Ficolin forms complexes with MASP-1 and MASP-2, recognizes certain types of bacteria and subsequently activates the lectin pathway (1).

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Ficolin-1 Antibody (NBP1-84705)(1)

Publication using NBP1-84705

• Sterba J, Dupejova J, Fiser M et al. Fibrinogen-related proteins in ixodid ticks. Parasit Vectors 2011-07-01 [PMID: 21729260]

Bioinformatics

• Gene Symbol: FCN1