FGF acidic/FGF1 Antibody (3X3E5)

Western Blot: FGF acidic/FGF1 Antibody (3X3E5) [NBP3-16609] - Western blot analysis of extracts of various cell lines, using FGF acidic/FGF1 Rabbit mAb (NBP3-16609) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 10s.

Immunocytochemistry/ Immunofluorescence: FGF acidic/FGF1 Antibody (3X3E5) [NBP3-16609] - Confocal imaging of NIH/3T3 cells using FGF acidic/FGF1 Rabbit mAb followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) .The cells were counterstained with alpha-Tubulin Mouse mAb followed by incubation with ABflo 488-conjugated Goat Anti-Mouse IgG (H+L) Ab (Green). DAPI was used for nuclear staining (Blue). Objective: 100x.

Immunocytochemistry/ Immunofluorescence: FGF acidic/FGF1 Antibody (3X3E5) [NBP3-16609] - Confocal imaging of U-2 OS cells using FGF acidic/FGF1 Rabbit mAb followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) . The cells were counterstained with alpha-Tubulin Mouse mAb followed by incubation with ABflo 488-conjugated Goat Anti-Mouse IgG (H+L) Ab (Green). DAPI was used for nuclear staining (Blue). Objective: 100x.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF
• Clone: 3X3E5
• Clonality: Monoclonal
• Host: Rabbit
• Conjugate: Unconjugated

FGF acidic/FGF1 Antibody (3X3E5) Summary

• Description: Novus Biologicals Rabbit FGF acidic/FGF1 Antibody (3X3E5) (NBP3-16609) is a recombinant monoclonal antibody validated for use in WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Additional Information: Recombinant Monoclonal Antibody
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 56-155 of human FGF acidic/FGF1 (P05230). HIQLQLSAESVGEVYIKSTETGQYLAMDTDGLLYGSQTPNEECLFLERLEENHYNTYISKKHAEKNWFVGLKKNGSCKRGPRTHYGQKAILFLPLPVSSD
• Source: HEK293
• Isotype: IgG
• Clonality: Monoclonal
• Host: Rabbit
• Gene: FGF1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 1:50 - 1:200
  • Western Blot 1:500 - 1:1000

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol, 0.05% BSA
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for FGF acidic/FGF1 Antibody (3X3E5)

• aFGF
• alpha
• alpha-ECGF
• beta-ECGF
• ECGF
• ECGFB
• ECGF-betaAcidic fibroblast growth factor
• endothelial cell growth factor, beta
• FGF acidic
• FGF-1
• FGFABeta-endothelial cell growth factor
• FGF-alpha
• fibroblast growth factor 1 (acidic)
• GLIO703
• HBGF1
• HBGF-1
• heparin-binding growth factor 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: FGF1