FGF-3 Antibody

Images

 
Immunohistochemistry-Paraffin: FGF-3 Antibody [NBP1-89718] - Staining of human placenta shows strong nuclear and cytoplasmic positivity in trophoblastic cells and moderate cytoplasmic positivity in decidua cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

FGF-3 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:RGRLYASEHYSAECEFVERIHELGYNTYASRLYRTVSSTPGARRQPSAERLWYVSVNGKGRPRRGFKTRRTQKSSLFLPRVLDHRDHEMVRQLQSGLPRPPGKGVQPRRRRQKQSPDNLEPS
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
FGF3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
FGF-3 Protein (NBP1-89718PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (80%), Rat (81%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for FGF-3 Antibody

  • FGF3
  • FGF-3
  • fibroblast growth factor 3 (murine mammary tumor virus integration site (v-int-2) oncogene homolog)
  • fibroblast growth factor 3
  • HBGF-3
  • Hst
  • INT-2
  • mouse
  • oncogene INT2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-32840
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC-P, IP
NBP2-00932
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB600-335
Species: Hu, Mu, Ec, NA
Applications: WB, ELISA, ICC/IF, IHC-Fr, IP
MAB766
Species: Hu
Applications: WB, Flow, CyTOF-ready
AF231
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
NBP2-15971
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
232-FA/CF
Species: Hu
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP2-44179
Species: Mu
Applications: WB, ELISA
AF1620
Species: Mu
Applications: WB, IHC
NB600-1287
Species: Hu, Mu, Rt
Applications: WB, Flow, IP, CyTOF-ready
NBP1-89718
Species: Hu
Applications: IHC, IHC-P

Publications for FGF-3 Antibody (NBP1-89718) (0)

There are no publications for FGF-3 Antibody (NBP1-89718).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FGF-3 Antibody (NBP1-89718) (0)

There are no reviews for FGF-3 Antibody (NBP1-89718). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for FGF-3 Antibody (NBP1-89718) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional FGF-3 Products

Bioinformatics Tool for FGF-3 Antibody (NBP1-89718)

Discover related pathways, diseases and genes to FGF-3 Antibody (NBP1-89718). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for FGF-3 Antibody (NBP1-89718)

Discover more about diseases related to FGF-3 Antibody (NBP1-89718).
 

Pathways for FGF-3 Antibody (NBP1-89718)

View related products by pathway.

PTMs for FGF-3 Antibody (NBP1-89718)

Learn more about PTMs related to FGF-3 Antibody (NBP1-89718).
 

Research Areas for FGF-3 Antibody (NBP1-89718)

Find related products by research area.

Blogs on FGF-3

There are no specific blogs for FGF-3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our FGF-3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol FGF3
Entrez