FEZF1 Antibody


Immunohistochemistry-Paraffin: FEZF1 Antibody [NBP2-57999] - Staining of human hypothalamus shows moderate positivity in processes.

Product Details

Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC, IHC-P

Order Details

FEZF1 Antibody Summary

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: YLAERNKLVVPAVEKYPSGVAFKDLSQAQLQHYMKESAQLLSEKIAFKTSDFSRGSPNAKPKV
Specificity of human FEZF1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (98%), Rat (95%). Backed by our 100% Guarantee.
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
FEZF1 Recombinant Protein Antigen (NBP2-57999PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Affinity purified

Alternate Names for FEZF1 Antibody

  • FEZ family zinc finger 1
  • FEZ
  • zinc finger protein 312B
  • ZNF312B


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IF
Species: Hu
Applications: WB, IHC, ICC
Species: Hu
Species: Hu
Applications: WB, IHC, IP
Species: Hu, Mk
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: IHC, IHC-P

Publications for FEZF1 Antibody (NBP2-57999) (0)

There are no publications for FEZF1 Antibody (NBP2-57999).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FEZF1 Antibody (NBP2-57999) (0)

There are no reviews for FEZF1 Antibody (NBP2-57999). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for FEZF1 Antibody (NBP2-57999) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Array Products

Array NBP2-57999

Bioinformatics Tool for FEZF1 Antibody (NBP2-57999)

Discover related pathways, diseases and genes to FEZF1 Antibody (NBP2-57999). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for FEZF1 Antibody (NBP2-57999)

Discover more about diseases related to FEZF1 Antibody (NBP2-57999).

Pathways for FEZF1 Antibody (NBP2-57999)

View related products by pathway.

Blogs on FEZF1

There are no specific blogs for FEZF1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our FEZF1 Antibody and receive a gift card or discount.


Gene Symbol FEZF1