Fetuin A/AHSG Antibody - BSA Free Summary
| Description |
Novus Biologicals Rabbit Fetuin A/AHSG Antibody - BSA Free (NBP1-90303) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. Anti-Fetuin A/AHSG Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen |
This antibody was developed against Recombinant Protein corresponding to amino acids: LPPSTYVEFTVSGTDCVAKEATEAAKCNLLAEKQYGFCKATLSEKLGGAEVAVTCMVFQTQPVSSQPQPEGANEAVPTPVVDPDAPPSPPLGAPGLPPAGSPPDSHVLLAAPPGHQLHRAHYDLRHTFMGVVSLGSPS |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
AHSG |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
- Immunohistochemistry 1:200 - 1:500
- Immunohistochemistry-Paraffin 1:50-1:200
- Knockdown Validated
- Western Blot 0.04-0.4 ug/ml
|
| Application Notes |
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
| Control Peptide |
|
| Publications |
|
Reactivity Notes
Reactivity reported in scientific literature (PMID: 23284864)
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.2) and 40% Glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for Fetuin A/AHSG Antibody - BSA Free
Background
Human fetuin (2-Heremans-Schmid-glycoprotein or a2-HS glycoprotein) is a major plasma glycoprotein predominantly synthesized in the liver. Human fetuin is named after its bovine homolog. Fetuins are found in most mammals. Human fetuin is a negative acute-phase protein; normal circulating levels in adults (300600 g/ml) fall significantly (3050%) during injury and infection. The biological role of fetuin is unknown, although it has been implicated as an immunomodulator that can participate in stimulation of bacterial phagocytosis by neutrophils and promotion of endocytosis by mouse macrophages. Hepatocytes are the principal cell source of circulating fetuin, but it also is expressed by monocyte/macrophages. Fetuins occur in large amounts in blood and cerebrospinal fluid and accumulate to high concentrations in calcified bone. The fetuin promoter region has several potential interleukin 6-responsive elements, and its synthesis is down-regulated during injury and inflammation. Fetuin is an acidic glycoprotein with three N-linked and three O-linked oligosaccharide chains, whose terminal sugar residues are rich in sialic acid (N-acetylneuraminic acid), contributing to its net negative charge. A role for fetuin as a carrier of bioactive molecules has been proposed based on observations that it binds and carries Ca2+ ion. Fetuin is implicated in bone remodeling, immune function and may play a role in tumor progression of certain cell types. Fetuin plays a role as an anti-inflammatory agent by suppressing the release of TNF from stimulated macrophages. Fetuin also interacts with members of the matrix metalloprotease family of zinc dependent secreted transmembrane proteins that degrade basement membranes and extracellular matrix components. The biological activity of fetuin is mediated through its direct interaction with other proteins. Fetuin down-regulates a number of receptor tyrosine kinase family members. A motif within fetuin has homology to the TGF-b receptor type II. Circulating human plasma fetuin is partly phosphorylated which implies that phosphorylated fetuin may have a physiological function in vivo. Human fetuin isolated from plasma is a two-chain molecule consisting of a A-chain of 322 amino acid residues (53 kDa) and a B-chain of 27 residues (5 kDa). The carboxy terminal 40 amino acids of the A chain constitute a bridging peptide that may be removed proteolytically in vivo. A single mRNA encodes both the A and B chains. The apparent molecular weight of intact human fetuin is 58 kDa.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: ELISA
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ICC, IHC, ICFlow, Simple Western, WB
Species: Mu
Applications: ELISA
Species: Hu
Applications: ELISA
Species: Bv, Hu, Mu
Applications: ICC, IHC
Species: Mu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), ICC, IHC, Neut, WB
Species: Hu
Applications: IHC, WB
Species: Hu, Mu, Rt
Applications: WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: IHC, IHC-P
Species: Hu
Applications: BA
Species: Hu
Applications: ELISA
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu, Mu
Applications: IHC, IHC-P, IP, WB
Species: Hu
Applications: ELISA
Species: Mu
Applications: IHC
Species: Hu
Applications: BA
Species: Hu
Applications: IHC, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: WB, ICC/IF, IHC, Mycoplasma
Publications for Fetuin A/AHSG Antibody (NBP1-90303)(1)
Showing Publication 1 -
1 of 1.
Reviews for Fetuin A/AHSG Antibody (NBP1-90303) (0)
There are no reviews for Fetuin A/AHSG Antibody (NBP1-90303).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for Fetuin A/AHSG Antibody (NBP1-90303) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional Fetuin A/AHSG Products
Research Areas for Fetuin A/AHSG Antibody (NBP1-90303)
Find related products by research area.
|
Blogs on Fetuin A/AHSG