Fetuin A/AHSG Antibody

Images

 
Western Blot: Fetuin A/AHSG Antibody [NBP1-90302] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate ...read more
Immunocytochemistry/ Immunofluorescence: Fetuin A/AHSG Antibody [NBP1-90302] - Staining of human cell line Hep G2 shows localization to the Golgi apparatus. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: Fetuin A/AHSG Antibody [NBP1-90302] - Staining of human kidney shows extra-cellular positivity in blood vessels and cytoplasmic positivity in cells of renal tubules.

Product Details

Summary
Reactivity Hu, PoSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Fetuin A/AHSG Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:GLIYRQPNCDDPETEEAALVAIDYINQNLPWGYKHTLNQIDEVKVWPQQPSGELFEIEIDTLETTCHVLDPTPVARCSVRQLKEHAVEGDCDFQLLKLDGKFSVVYAKCDSSPDSAEDVRKVCQDCPLLAPLNDTRVVHAAKAALA
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
AHSG
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Fetuin A/AHSG Protein (NBP1-90302PEP)
Publications
Read Publications using
NBP1-90302 in the following applications:

  • WB
    1 publication

Reactivity Notes

Porcine reactivity reported in scientific literature (PMID: 24862986).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Fetuin A/AHSG Antibody

  • A2HS
  • AHS
  • AHSG
  • alpha-2-HS-glycoprotein
  • alpha-2-Z-globulin
  • Ba-alpha-2-glycoprotein
  • FETUAba-alpha-2-glycoprotein
  • Fetuin A
  • fetuin-A
  • HSGA

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB600-41532
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB100-56505
Species: Hu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
AF808
Species: Mu
Applications: WB, IHC, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)
NBP2-35213
Species: Hu
AF5739
Species: Hu, Mu, Rt
Applications: WB
NBP1-47863
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF6146
Species: Hu
Applications: ICC
NB500-418
Species: Hu, Po, Rb
Applications: WB, B/N, ELISA, ICC/IF, IHC, IHC-P, RIA
AF4409
Species: Mu
Applications: WB
NBP2-45844
Species: Hu
Applications: WB, IHC
NBP2-12793
Species: Hu, Mu
Applications: WB, IP
2629-FG/CF
Species: Mu
MAB3694
Species: Hu
Applications: WB, IHC
NB100-56703
Species: Hu, Mu
Applications: WB, IHC, IHC-Fr

Publications for Fetuin A/AHSG Antibody (NBP1-90302)(2)

We have publications tested in 1 confirmed species: Porcine.

We have publications tested in 1 application: WB.


Filter By Application
WB
(1)
All Applications
Filter By Species
Porcine
(1)
All Species

Reviews for Fetuin A/AHSG Antibody (NBP1-90302) (0)

There are no reviews for Fetuin A/AHSG Antibody (NBP1-90302). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Fetuin A/AHSG Antibody (NBP1-90302) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Fetuin A/AHSG Products

Bioinformatics Tool for Fetuin A/AHSG Antibody (NBP1-90302)

Discover related pathways, diseases and genes to Fetuin A/AHSG Antibody (NBP1-90302). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Fetuin A/AHSG Antibody (NBP1-90302)

Discover more about diseases related to Fetuin A/AHSG Antibody (NBP1-90302).
 

Pathways for Fetuin A/AHSG Antibody (NBP1-90302)

View related products by pathway.

PTMs for Fetuin A/AHSG Antibody (NBP1-90302)

Learn more about PTMs related to Fetuin A/AHSG Antibody (NBP1-90302).
 

Research Areas for Fetuin A/AHSG Antibody (NBP1-90302)

Find related products by research area.

Blogs on Fetuin A/AHSG

There are no specific blogs for Fetuin A/AHSG, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Fetuin A/AHSG Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol AHSG
Entrez