Staining of human cell line Hep G2 shows localization to the Golgi apparatus.
Independent Antibodies: Immunohistochemistry-Paraffin: Fetuin A/AHSG Antibody [NBP1-90302] - Staining of human bone marrow, cerebral cortex, liver and lymph node using Anti-AHSG antibody NBP1-90302 (A) shows ...read more
Immunohistochemistry-Paraffin: Fetuin A/AHSG Antibody [NBP1-90302] - Staining of human bone marrow.
Immunohistochemistry-Paraffin: Fetuin A/AHSG Antibody [NBP1-90302] - Staining of human liver.
Immunohistochemistry-Paraffin: Fetuin A/AHSG Antibody [NBP1-90302] - Staining of human cerebellum shows moderate cytoplasmic positivity in a subset of Purkinje cells.
Immunohistochemistry-Paraffin: Fetuin A/AHSG Antibody [NBP1-90302] - Staining of human cerebral cortex.
Immunohistochemistry-Paraffin: Fetuin A/AHSG Antibody [NBP1-90302] - Staining of human kidney shows moderate extra-cellular positivity and moderate cytoplasmic positivity in cells in tubules.
Staining of human skeletal muscle shows no cytoplasmic positivity in myocytes as expected.
Immunohistochemistry-Paraffin: Fetuin A/AHSG Antibody [NBP1-90302] - Staining of human lymph node.
Staining of human stomach shows moderate positivity in extracellular matrix.
Genetic Strategies: Analysis in Caco-2 cells transfected with control siRNA, target specific siRNA probe #1 and #2. Remaining relative intensity is presented. Loading control: Anti-GAPDH.
Novus Biologicals Rabbit Fetuin A/AHSG Antibody - BSA Free (NBP1-90302) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. Anti-Fetuin A/AHSG Antibody: Cited in 2 publications. All Novus Biologicals antibodies are covered by our 100% guarantee.
Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: GLIYRQPNCDDPETEEAALVAIDYINQNLPWGYKHTLNQIDEVKVWPQQPSGELFEIEIDTLETTCHVLDPTPVARCSVRQLKEHAVEGDCDFQLLKLDGKFSVVYAKCDSSPDSAEDVRKVCQDCPLLAPLNDTRVVHAAKAALA
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
AHSG
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Porcine reactivity reported in scientific literature (PMID: 24862986).
Packaging, Storage & Formulations
Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified
Alternate Names for Fetuin A/AHSG Antibody - BSA Free
A2HS
AHS
AHSG
alpha-2-HS-glycoprotein
alpha-2-Z-globulin
Ba-alpha-2-glycoprotein
FETUAba-alpha-2-glycoprotein
Fetuin A
fetuin-A
HSGA
Background
Human fetuin (2-Heremans-Schmid-glycoprotein or a2-HS glycoprotein) is a major plasma glycoprotein predominantly synthesized in the liver. Human fetuin is named after its bovine homolog. Fetuins are found in most mammals. Human fetuin is a negative acute-phase protein; normal circulating levels in adults (300600 g/ml) fall significantly (3050%) during injury and infection. The biological role of fetuin is unknown, although it has been implicated as an immunomodulator that can participate in stimulation of bacterial phagocytosis by neutrophils and promotion of endocytosis by mouse macrophages. Hepatocytes are the principal cell source of circulating fetuin, but it also is expressed by monocyte/macrophages. Fetuins occur in large amounts in blood and cerebrospinal fluid and accumulate to high concentrations in calcified bone. The fetuin promoter region has several potential interleukin 6-responsive elements, and its synthesis is down-regulated during injury and inflammation. Fetuin is an acidic glycoprotein with three N-linked and three O-linked oligosaccharide chains, whose terminal sugar residues are rich in sialic acid (N-acetylneuraminic acid), contributing to its net negative charge. A role for fetuin as a carrier of bioactive molecules has been proposed based on observations that it binds and carries Ca2+ ion. Fetuin is implicated in bone remodeling, immune function and may play a role in tumor progression of certain cell types. Fetuin plays a role as an anti-inflammatory agent by suppressing the release of TNF from stimulated macrophages. Fetuin also interacts with members of the matrix metalloprotease family of zinc dependent secreted transmembrane proteins that degrade basement membranes and extracellular matrix components. The biological activity of fetuin is mediated through its direct interaction with other proteins. Fetuin down-regulates a number of receptor tyrosine kinase family members. A motif within fetuin has homology to the TGF-b receptor type II. Circulating human plasma fetuin is partly phosphorylated which implies that phosphorylated fetuin may have a physiological function in vivo. Human fetuin isolated from plasma is a two-chain molecule consisting of a A-chain of 322 amino acid residues (53 kDa) and a B-chain of 27 residues (5 kDa). The carboxy terminal 40 amino acids of the A chain constitute a bridging peptide that may be removed proteolytically in vivo. A single mRNA encodes both the A and B chains. The apparent molecular weight of intact human fetuin is 58 kDa.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
=
÷
Review this Product
Be the first to review our Fetuin A/AHSG Antibody - BSA Free and receive a gift card or discount.