Fes Antibody

Images

 
Immunohistochemistry-Paraffin: Fes Antibody [NBP1-83429] - Staining of human testis shows strong nuclear positivity in cells of seminiferus ducts

Product Details

Summary
Reactivity Hu, RtSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Fes Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:DSAQAKRKYQEASKDKDRDKAKDKYVRSLWKLFAHHNRYVLGVRAAQLHHQHHHQLLLPGLLRSLQDLHEEMACILKEILQEYLEISSLVQDEVVAIHREMAAAAARIQPEAEYQGFLRQYGSAPDVPPCVTFDESLLEEGEPLEP
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Rat (90%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
FES
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Fes Protein (NBP1-83429PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (88%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Fes Antibody

  • EC 2.7.10
  • EC 2.7.10.2
  • feline sarcoma oncogene
  • feline sarcoma virus
  • Fes
  • FPS
  • Proto-oncogene c-Fes
  • Proto-oncogene c-Fps
  • proto-oncogene tyrosine-protein kinase Fes/Fps
  • tyrosine-protein kinase Fes/Fps

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF2685
Species: Hu
Applications: WB, Simple Western, IHC
NBP1-20089
Species: Hu
Applications: WB, ICC/IF
NBP2-16463
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
AF5414
Species: Hu
Applications: WB, Simple Western
NBP1-83368
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-49154
Species: Hu
Applications: IHC
NB600-335
Species: Hu, Mu, Ec, NA
Applications: WB, ELISA, ICC/IF, IHC-Fr, IP
NBP1-19371
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NB100-74413
Species: Hu, Mu, Rb
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-45562
Species: Hu
Applications: WB, Flow, IHC
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NBP1-32108
Species: Hu, Rt
Applications: WB, ICC/IF
H00009322-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IP

Publications for Fes Antibody (NBP1-83429) (0)

There are no publications for Fes Antibody (NBP1-83429).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Fes Antibody (NBP1-83429) (0)

There are no reviews for Fes Antibody (NBP1-83429). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for Fes Antibody (NBP1-83429) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Fes Products

Bioinformatics Tool for Fes Antibody (NBP1-83429)

Discover related pathways, diseases and genes to Fes Antibody (NBP1-83429). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Fes Antibody (NBP1-83429)

Discover more about diseases related to Fes Antibody (NBP1-83429).
 

Pathways for Fes Antibody (NBP1-83429)

View related products by pathway.

PTMs for Fes Antibody (NBP1-83429)

Learn more about PTMs related to Fes Antibody (NBP1-83429).
 

Research Areas for Fes Antibody (NBP1-83429)

Find related products by research area.

Blogs on Fes

There are no specific blogs for Fes, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Fes Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol FES
Entrez