FEM1C Antibody


Western Blot: FEM1C Antibody [NBP2-32501] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunocytochemistry/ Immunofluorescence: FEM1C Antibody [NBP2-32501] - Immunofluorescent staining of human cell line RH-30 shows localization to nucleoplasm.
Immunohistochemistry-Paraffin: FEM1C Antibody [NBP2-32501] - Staining of human testis shows moderate cytoplasmic positivity in cells in seminiferous ducts and Leydig cells.

Product Details

Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P

Order Details

FEM1C Antibody Summary

This antibody was developed against a recombinant protein corresponding to amino acids: NLLIKSGAHFDATNLHKQTASDLLDEKEIAKNLIQPINHTTLQCLAARVIVNHRIYYKGHI
Specificity of human FEM1C antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (98%), Rat (98%). Backed by our 100% Guarantee.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
FEM1C Protein (NBP2-32501PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for FEM1C Antibody

  • EUROIMAGE686608
  • EUROIMAGE783647
  • fem-1 homolog c (C. elegans)
  • FEM1A
  • FEM1c
  • KIAA1785FEM1-gamma
  • protein fem-1 homolog C


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Bv, Ca, Ch, Xp
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
Species: Hu, Mu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt, Po
Applications: WB, Simple Western, IB, ICC/IF, IP
Species: Hu
Applications: WB, IP
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
Species: Hu, Mu, Rt, Fe
Applications: WB, ICC/IF, IHC, IHC-Fr, IP
Species: Mu, Ha
Applications: Flow, IHC, IP
Species: Hu, Ca
Applications: WB, B/N, Flow, ICC/IF, IHC-P, IP, Flow-CS
Species: Hu, Mu, Rt
Applications: WB, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, CyTOF-ready, ELISA(Cap), Flow-CS, Flow-IC
Species: Hu, Mu, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
Species: Hu, Mu
Applications: WB, Flow, IHC-P
Species: Hu
Applications: WB, Simple Western, ChIP, ICC/IF, IHC, IHC-P, IP
Species: Hu
Applications: WB, ELISA
Species: Hu
Applications: Flow, Func, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ELISA
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP, PLA
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for FEM1C Antibody (NBP2-32501) (0)

There are no publications for FEM1C Antibody (NBP2-32501).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FEM1C Antibody (NBP2-32501) (0)

There are no reviews for FEM1C Antibody (NBP2-32501). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for FEM1C Antibody (NBP2-32501) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional FEM1C Products

Bioinformatics Tool for FEM1C Antibody (NBP2-32501)

Discover related pathways, diseases and genes to FEM1C Antibody (NBP2-32501). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for FEM1C Antibody (NBP2-32501)

Discover more about diseases related to FEM1C Antibody (NBP2-32501).

Pathways for FEM1C Antibody (NBP2-32501)

View related products by pathway.

PTMs for FEM1C Antibody (NBP2-32501)

Learn more about PTMs related to FEM1C Antibody (NBP2-32501).

Blogs on FEM1C

There are no specific blogs for FEM1C, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our FEM1C Antibody and receive a gift card or discount.


Gene Symbol FEM1C