FEM1C Antibody

Images

 
Western Blot: FEM1C Antibody [NBP2-32501] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunocytochemistry/ Immunofluorescence: FEM1C Antibody [NBP2-32501] - Immunofluorescent staining of human cell line RH-30 shows localization to nucleoplasm.
Immunohistochemistry-Paraffin: FEM1C Antibody [NBP2-32501] - Staining of human testis shows moderate cytoplasmic positivity in cells in seminiferous ducts and Leydig cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

FEM1C Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: NLLIKSGAHFDATNLHKQTASDLLDEKEIAKNLIQPINHTTLQCLAARVIVNHRIYYKGHI
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (98%), Rat (98%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
FEM1C
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:250
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
FEM1C Protein (NBP2-32501PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for FEM1C Antibody

  • EUROIMAGE686608
  • EUROIMAGE783647
  • fem-1 homolog c (C. elegans)
  • FEM1A
  • FEM1c
  • KIAA1785FEM1-gamma
  • protein fem-1 homolog C

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-77300
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-29323
Species: Hu, Mu, Rt, Bv, Ca, Ch, Xp
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP1-84833
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NB120-13810
Species: Hu, Mu, Rt, Po
Applications: WB, Simple Western, IB, ICC/IF, IP
NBP1-71805
Species: Hu
Applications: WB, IP
NBP1-47833
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-47836
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NB100-56511
Species: Hu, Mu, Rt, Fe
Applications: WB, ICC/IF, IHC, IHC-Fr, IP
NBP1-43461
Species: Mu
Applications: Flow, IHC, IP
NB100-56722
Species: Hu, Ca
Applications: WB, B/N, Flow, Func, ICC/IF, IHC-P, IP, Flow-CS
NB100-56566
Species: Hu, Mu, Rt
Applications: WB, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, CyTOF-ready, Flow-CS, Flow-IC
NBP2-24875
Species: Hu, Mu, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
NBP2-29950
Species: Hu, Mu
Applications: WB, Flow, IHC-P
NB100-1669
Species: Hu
Applications: WB, Simple Western, ChIP, ICC/IF, IHC, IHC-P, IP
H00006223-M01
Species: Hu
Applications: WB, ELISA
DDX0131P-100
Species: Hu
Applications: Flow, Func, ICC/IF, IHC, IHC-Fr, IHC-P
H00057410-M02
Species: Hu, Mu, Rt
Applications: WB, ELISA
NB600-233
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP, PLA
NBP2-42073
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for FEM1C Antibody (NBP2-32501) (0)

There are no publications for FEM1C Antibody (NBP2-32501).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FEM1C Antibody (NBP2-32501) (0)

There are no reviews for FEM1C Antibody (NBP2-32501). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for FEM1C Antibody (NBP2-32501) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional FEM1C Products

Bioinformatics Tool for FEM1C Antibody (NBP2-32501)

Discover related pathways, diseases and genes to FEM1C Antibody (NBP2-32501). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for FEM1C Antibody (NBP2-32501)

Discover more about diseases related to FEM1C Antibody (NBP2-32501).
 

Pathways for FEM1C Antibody (NBP2-32501)

View related products by pathway.

PTMs for FEM1C Antibody (NBP2-32501)

Learn more about PTMs related to FEM1C Antibody (NBP2-32501).

Blogs on FEM1C

There are no specific blogs for FEM1C, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our FEM1C Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol FEM1C