FE65 Antibody


Immunocytochemistry/ Immunofluorescence: FE65 Antibody [NBP2-48682] - Immunofluorescent staining of human cell line HEK 293 shows localization to plasma membrane.
Immunohistochemistry-Paraffin: FE65 Antibody [NBP2-48682] - Staining of human cerebral cortex shows neuropil and cytoplasmic positivity in neurons.

Product Details

Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P

Order Details

FE65 Antibody Summary

This antibody was developed against a recombinant protein corresponding to amino acids: QEESQLTWTGFAHGEGFEDGEFWKDEPSDEAPMELGLKEPEEGTLTFPAQSLSPEPLPQEEEKLPPRNTNPGI
Specificity of human FE65 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide

Reactivity Notes

Mouse (86%), Rat (86%)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for FE65 Antibody

  • adaptor protein FE65a2
  • amyloid beta (A4) precursor protein-binding, family B, member 1 (Fe65)
  • amyloid beta A4 precursor protein-binding, family B, member 1
  • Fe65
  • FE65amyloid beta A4 precursor protein-binding family B member 1
  • MGC:9072
  • Protein Fe65
  • RIR
  • stat-like protein


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt, Mk
Applications: WB, DB, ELISA, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, IHC-FrFl
Species: Hu
Applications: WB, Simple Western, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu
Applications: WB, IHC, CyTOF-ready, ICFlow
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, KD
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P, PLA
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, CyTOF-ready
Species: Hu
Applications: WB, Flow, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB
Species: Hu, Mu, Rt, Pm
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, KO
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
Species: Hu, Mu, Po, Bt, Bv, Ca, Eq, Ha, Mk, Pm, Rb
Applications: IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for FE65 Antibody (NBP2-48682) (0)

There are no publications for FE65 Antibody (NBP2-48682).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FE65 Antibody (NBP2-48682) (0)

There are no reviews for FE65 Antibody (NBP2-48682). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for FE65 Antibody (NBP2-48682) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Other Available Formats

Additional FE65 Products

Bioinformatics Tool for FE65 Antibody (NBP2-48682)

Discover related pathways, diseases and genes to FE65 Antibody (NBP2-48682). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for FE65 Antibody (NBP2-48682)

Discover more about diseases related to FE65 Antibody (NBP2-48682).

Pathways for FE65 Antibody (NBP2-48682)

View related products by pathway.

PTMs for FE65 Antibody (NBP2-48682)

Learn more about PTMs related to FE65 Antibody (NBP2-48682).

Research Areas for FE65 Antibody (NBP2-48682)

Find related products by research area.

Blogs on FE65

There are no specific blogs for FE65, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our FE65 Antibody and receive a gift card or discount.


Gene Symbol APBB1