APBB2 Antibody

Images

 
Western Blot: APBB2 Antibody [NBP1-84700] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate (Co-expressed with ...read more
Immunocytochemistry/ Immunofluorescence: APBB2 Antibody [NBP1-84700] - Staining of human cell line U-251MG shows positivity in mitochondria.
Immunohistochemistry-Paraffin: APBB2 Antibody [NBP1-84700] - Staining of human pancreas shows distinct granular positivity in exocrine cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

APBB2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:SEKLEGKEPHPQDSSSCEILPSQPRRTKSFLNYYADLETSARELEQNRGNHHGTAEEKSQPVQGQASTIIGNGDLLLQKPNRPQSSPEDGQVATVSSSPETKKDHPKTGAKTDCALHRIQNLAPS
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
APBB2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
APBB2 Protein (NBP1-84700PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (85%).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for APBB2 Antibody

  • amyloid beta (A4) precursor protein-binding, family B, member 2
  • amyloid beta A4 precursor protein-binding family B member 2
  • DKFZp434E033
  • FE65L1FE65LMGC35575
  • Fe65-like 1
  • Protein Fe65-like 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB110-58360
Species: Hu, Mu, Rt
Applications: WB, IP
NBP2-13075
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP, IHC-FrFl
NBP2-01367
Species: Hu
Applications: WB, Flow, IHC, IHC-P
AF3129
Species: Hu
Applications: WB, IHC, IP
MAB17761
Species: Hu, Mu, Rt
Applications: WB, ICC
NB110-60531
Species: Hu, Mu, Rt(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, CyTOF-ready
NBP1-89029
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
NBP2-25162
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
NBP1-33456
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-52506
Species: Hu
Applications: WB, ELISA, Flow, IHC, CyTOF-ready, ICC, IF
MAB931
Species: Hu, Mu
Applications: WB, IHC, CyTOF-ready, ICFlow
NBP2-41182
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
NBP2-34390
Species: Hu
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP
NBP2-24613
Species: Hu
Applications: WB, Simple Western, IHC-P
NB100-56169
Species: Hu
Applications: WB, IHC, IHC-P, IP
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP1-33560
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for APBB2 Antibody (NBP1-84700) (0)

There are no publications for APBB2 Antibody (NBP1-84700).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for APBB2 Antibody (NBP1-84700) (0)

There are no reviews for APBB2 Antibody (NBP1-84700). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for APBB2 Antibody (NBP1-84700) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional APBB2 Products

Bioinformatics Tool for APBB2 Antibody (NBP1-84700)

Discover related pathways, diseases and genes to APBB2 Antibody (NBP1-84700). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for APBB2 Antibody (NBP1-84700)

Discover more about diseases related to APBB2 Antibody (NBP1-84700).
 

Pathways for APBB2 Antibody (NBP1-84700)

View related products by pathway.

PTMs for APBB2 Antibody (NBP1-84700)

Learn more about PTMs related to APBB2 Antibody (NBP1-84700).
 

Research Areas for APBB2 Antibody (NBP1-84700)

Find related products by research area.

Blogs on APBB2

There are no specific blogs for APBB2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our APBB2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol APBB2
Entrez
Uniprot