FDX1 Antibody (1G9)

Images

 
Western Blot: FDX1 Antibody (1G9) [H00002230-M03] - Detection against Immunogen (36.63 KDa).

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
1G9
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

FDX1 Antibody (1G9) Summary

Immunogen
FDX1 (NP_004100.1 85 a.a. - 183 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. VGDSLLDVVVENNLDIDGFGACEGTLACSTCHLIFEDHIYEKLDAITDEENDMLDLAYGLTDRSRLGCQICLTKSMDNMTVRVPETVADARQSIDVGKT
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
FDX1
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
Application Notes
It has been used for ELISA and WB.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for FDX1 Antibody (1G9)

  • Adrenal ferredoxin
  • adrenodoxin, mitochondrial
  • ADXhepatoredoxin
  • FDX
  • ferredoxin 1
  • ferredoxin-1
  • Hepatoredoxin
  • LOH11CR1D
  • mitochondrial adrenodoxin

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-1533
Species: Hu, Mu, Po, Sh
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
NBP1-35703
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NB300-731
Species: Hu, Mu, Rt, GP, Rb, Sh, Ye
Applications: WB, ChIP, B/N, Flow, GS, ICC/IF, IHC, IHC-P, IP
H00001325-P01
Species: Hu
NB100-65214
Species: Hu, Mu, Rt, Ma
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
7570-GH
Species: Hu
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP2-16684
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
9134-TN
Species: Hu
AF245
Species: Hu
Applications: WB, Flow, CyTOF-ready
NBP2-12446
Species: Hu, Mu, Rt, Pm
Applications: WB, ICC/IF, IHC, IHC-P
AF2180
Species: Hu
Applications: WB, Simple Western, IP
NBP2-16468
Species: Hu, Rt
Applications: WB, IHC, IHC-P
NBP1-30027
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF682
Species: Hu
Applications: WB, IHC, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)
NB300-562
Species: Hu, Mu, Rt, Ch, Rb, Sh
Applications: WB, B/N, Flow, ICC/IF, IHC, IHC-P
NBP1-46535
Species: Hu, Mu, Rt, Rb, Xp, Ze
Applications: WB, IHC, IHC-Fr, IHC-P

Publications for FDX1 Antibody (H00002230-M03) (0)

There are no publications for FDX1 Antibody (H00002230-M03).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FDX1 Antibody (H00002230-M03) (0)

There are no reviews for FDX1 Antibody (H00002230-M03). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for FDX1 Antibody (H00002230-M03) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional FDX1 Products

Bioinformatics Tool for FDX1 Antibody (H00002230-M03)

Discover related pathways, diseases and genes to FDX1 Antibody (H00002230-M03). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for FDX1 Antibody (H00002230-M03)

Discover more about diseases related to FDX1 Antibody (H00002230-M03).
 

Pathways for FDX1 Antibody (H00002230-M03)

View related products by pathway.

PTMs for FDX1 Antibody (H00002230-M03)

Learn more about PTMs related to FDX1 Antibody (H00002230-M03).

Blogs on FDX1

There are no specific blogs for FDX1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our FDX1 Antibody (1G9) and receive a gift card or discount.

Bioinformatics

Gene Symbol FDX1
Uniprot