FDFT1 Antibody

Images

 
Western Blot: FDFT1 Antibody [NBP1-89560] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
Immunocytochemistry/ Immunofluorescence: FDFT1 Antibody [NBP1-89560] - Immunofluorescent staining of human cell line U-2 OS shows localization to endoplasmic reticulum.
Immunohistochemistry-Paraffin: FDFT1 Antibody [NBP1-89560] - Staining of human adrenal gland shows strong cytoplasmic positivity in cortical cells.
Western Blot: FDFT1 Antibody [NBP1-89560] - Analysis in human cell line HEK 293.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

FDFT1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:PEEFYNLVRFRIGGKRKVMPKMDQDSLSSSLKTCYKYLNQTSRSFAAVIQALDGEMRNAVCIFYLVLRALDTLEDDMTISVEKKVPLLHNFHSFLYQPDWRFMESKEKDRQVLEDFPTISLEFRNLAEKYQTVIADICR
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
FDFT1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
FDFT1 Protein (NBP1-89560PEP)
Publications
Read Publication using NBP1-89560.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for FDFT1 Antibody

  • DGPT
  • EC 2.5.1.21
  • ERG9
  • farnesyl-diphosphate farnesyltransferase 1
  • Farnesyl-diphosphate farnesyltransferase
  • FPP:FPP farnesyltransferase
  • presqualene-di-diphosphate synthase
  • SQS
  • squalene synthase
  • squalene synthetase
  • SS

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-16463
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-91996
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
NBP2-32001
Species: Hu, Mu
Applications: IHC, IHC-P
NBP1-83368
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-85445
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
MAB1228
Species: Hu
Applications: Flow, IHC, IP, CyTOF-ready
NB100-417
Species: Hu, Mu, Rt, Ca, Pl
Applications: WB, Simple Western, ChIP, ELISA, Flow, GS, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-78159
Species: Hu, Rt, Po, Bv
Applications: WB, EM, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vitro, RIA
NB600-582
Species: Hu, Mu, Rt, Ca, Ch, SyHa, Ha
Applications: WB, Simple Western
NBP1-54446
Species: Hu, Ch
Applications: WB, ELISA, GS, ICC/IF, IP
AF8516
Species: Hu
Applications: WB, Simple Western, IP, ICC
NBP2-34234
Species: Hu
Applications: ICC/IF, IHC-Fr, IHC-P
NBP1-82474
Species: Hu
Applications: WB, IHC, IHC-P
AF5535
Species: Hu
Applications: WB, Simple Western
NB600-233
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP, PLA
NB200-540
Species: Mu
Applications: WB, Flow, IA, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
MAB6799
Species: Hu
Applications: WB, IHC
NBP2-01223
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NBP1-89560
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for FDFT1 Antibody (NBP1-89560)(1)

Reviews for FDFT1 Antibody (NBP1-89560) (0)

There are no reviews for FDFT1 Antibody (NBP1-89560). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for FDFT1 Antibody (NBP1-89560) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional FDFT1 Products

Bioinformatics Tool for FDFT1 Antibody (NBP1-89560)

Discover related pathways, diseases and genes to FDFT1 Antibody (NBP1-89560). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for FDFT1 Antibody (NBP1-89560)

Discover more about diseases related to FDFT1 Antibody (NBP1-89560).
 

Pathways for FDFT1 Antibody (NBP1-89560)

View related products by pathway.

PTMs for FDFT1 Antibody (NBP1-89560)

Learn more about PTMs related to FDFT1 Antibody (NBP1-89560).

Blogs on FDFT1

There are no specific blogs for FDFT1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our FDFT1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol FDFT1