Home » FDFT1 » FDFT1 Antibodies » FDFT1 Antibody

FDFT1 Antibody

 (1 Publication)
 See All Related
Submit a Review

Images

 
(
Enlarge)
Western Blot: FDFT1 Antibody [NBP1-89560] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
Western Blot: FDFT1 Antibody [NBP1-89560] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
Immunocytochemistry/ Immunofluorescence: FDFT1 Antibody [NBP1-89560] - Staining of human cell line U-2 OS shows localization to endoplasmic reticulum. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: FDFT1 Antibody [NBP1-89560] - Staining of human adrenal gland shows strong cytoplasmic positivity in cortical cells.
Western Blot: FDFT1 Antibody [NBP1-89560] - Analysis in human cell line HEK 293.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

FDFT1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: PEEFYNLVRFRIGGKRKVMPKMDQDSLSSSLKTCYKYLNQTSRSFAAVIQALDGEMRNAVCIFYLVLRALDTLEDDMTISVEKKVPLLHNFHSFLYQPDWRFMESKEKDRQVLEDFPTISLEFRNLAEKYQTVIADICR
Specificity
Specificity of human, mouse, rat FDFT1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
FDFT1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control
FDFT1 Knockout 293T Cell Lysate
Control Peptide
Publications
Read Publication using NBP1-89560.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for FDFT1 Antibody

  • DGPT
  • EC 2.5.1.21
  • ERG9
  • farnesyl-diphosphate farnesyltransferase 1
  • Farnesyl-diphosphate farnesyltransferase
  • FPP:FPP farnesyltransferase
  • presqualene-di-diphosphate synthase
  • SQS
  • squalene synthase
  • squalene synthetase
  • SS

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

FDPS Antibody
NBP2-16463
Western Blot: FDPS Antibody [NBP2-16463] - Various whole cell extracts (30 ug) were separated by 10% SDS-PAGE, and the membrane was blotted with FDPS antibody [N1C3] diluted at 1:3000. The HRP-conjugated anti-rabbit IgG antibody (NBP2-19301) was used to detect the primary antibody.
Immunocytochemistry/Immunofluorescence: FDPS Antibody [NBP2-16463] - HeLa cells were fixed in ice-cold MeOH for 5 min. Green: FDPS protein stained by FDPS antibody [N1C3] diluted at 1:500. Blue: Hoechst 33342 staining. Scale bar = 10 um.
Immunohistochemistry-Paraffin: FDPS Antibody [NBP2-16463] - Paraffin-embedded mouse kidney. FDPS antibody [N1C3] dilution: 1:500.
(1 Review)
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
HMG-CoA
Reductase/HMGCR Antib ...
NBP2-66888
Western Blot: HMG-CoA Reductase/HMGCR Antibody (JF0981) [NBP2-66888] - Analysis of HMGCR on Hela cells lysates using anti-HMGCR antibody at 1/1,000 dilution.
Simple Western: HMG-CoA Reductase/HMGCR Antibody (JF0981) [NBP2-66888] - SVG-A whole cell lysate. Antibody at 1:25 dilution. Image from verified customer review.
(1 Review)
Species: Hu, Mu, Rt
Applications: WB, ChIP, IP
SQLE Antibody
NBP2-32001
Immunohistochemistry-Paraffin: SQLE Antibody [NBP2-32001] - Staining of human skin shows moderate cytoplasmic positivity in squamous epithelial cells.
Immunohistochemistry-Paraffin: SQLE Antibody [NBP2-32001] - Staining of human colon shows moderate cytoplasmic positivity in myocytes.
Immunohistochemistry-Paraffin: SQLE Antibody [NBP2-32001] - Staining of human placenta shows moderate cytoplasmic positivity in trophoblastic cells.
(1 Publication)
Species: Hu, Mu
Applications: WB, IHC, IHC-P
GGPS1 Antibody
NBP1-83368
Western Blot: GGPS1 Antibody [NBP1-83368] - Analysis in control (vector only transfected HEK293T lysate) and GGPS1 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
Immunohistochemistry-Paraffin: GGPS1 Antibody [NBP1-83368] - Staining in human testis and pancreas tissues using anti-GGPS1 antibody. Corresponding GGPS1 RNA-seq data are presented for the same tissues.
Western Blot: GGPS1 Antibody [NBP1-83368] - Analysis in human cell line RT-4.
Species: Hu
Applications: WB, IHC, IHC-P
MSX2 Antibody
NBP1-85445
Western Blot: MSX2 Antibody [NBP1-85445] - Analysis in Caco-2 cells transfected with control siRNA, target specific siRNA probe #1, using Anti-MSX2 antibody. Remaining relative intensity is presented. Loading control: Anti-PPIB.
Immunohistochemistry-Paraffin: MSX2 Antibody [NBP1-85445] - Staining of human placenta shows strong nuclear positivity in trophoblastic cells.
Western Blot: MSX2 Antibody [NBP1-85445] - Analysis in human cell line BEWO.
(3 Publications)
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
Glycophorin A
Antibody (R10) [Uncon ...
MAB1228
Glycophorin A was detected in immersion fixed paraffin-embedded sections of human lung using Mouse Anti-Human Glycophorin A Monoclonal Antibody (Catalog # MAB1228) at 1.7 µg/mL overnight at 4 °C. Tissue was stained using the Anti-Mouse HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS002) and counterstained with hematoxylin (blue). Specific staining was localized to cell membranes of red blood cells. View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
TF‑1 human erythroleukemic cell line was stained with Mouse Anti-Human Glycophorin A Monoclonal Antibody (Catalog # MAB1228, filled histogram) or isotype control antibody (Catalog # MAB002, open histogram), followed by Phycoerythrin-conjugated Anti-Mouse IgG Secondary Antibody (Catalog # F0102B).
(2 Publications)
Species: Hu
Applications: Flow, IHC, IP, CyTOF-ready
Carbonic Anhydrase
IX/CA9 Antibody
NB100-417
Immunohistochemistry-Paraffin: Carbonic Anhydrase IX/CA9 Antibody [NB100-417] - IHC analysis of a FFPE tissue section of human breast cancer using CAIX antibody at 1:1000 dilution. The primary antibody bound to CAIX antigens in the tissue section was detected using a HRP labeled secondary antibody and DAB reagent. Nuclei of the cells were counterstained with hematoxylin. This CAIX antibody generated an expected cytoplasmic staining of CAIX protein with an intense signal around the cellular membranes in tumor cores. The latter are more likely to be hypoxic in growing tumors which signifies that the observed CAIX staining is specific.
Western Blot: Carbonic Anhydrase IX/CA9 Antibody [NB100-417] - Analysis in 1) HeLa, 2) MDA-MB-231, and 3) A549 whole cell lysates. Specific bands were detected for Carbonic Anhydrase IX/CA9 at a molecular weight of 50 kDa.
Immunocytochemistry/Immunofluorescence: Carbonic Anhydrase IX/CA9 Antibody [NB100-417] - Analysis using the DyLight 488 conjugate of NB100-417. Staining of Carbonic Anhydrase IX (red) in human glioma U87 cells. DAPI counterstains nuclei (blue). Image from verified customer review.
(5 Reviews)
(180 Publications)
Species: Hu, Mu, Rt, Pl
Applications: WB, Simple Western, ChIP, ELISA, Flow, GS, IB, ICC/IF, IHC, IHC-Fr, IHC-P
LDLR Antibody (C7)
NBP1-78159
Western Blot: LDL R Antibody (C7) [NBP1-78159] - Total protein from human HeLa and HepG2 cells was separated on a 7.5% gel by SDS-PAGE, transferred to PVDF membrane and blocked in 5% non-fat milk in TBST. The membrane was probed with 0.5 ug/mL anti-LDL receptor in 1% non-fat milk in TBST and detected with an anti-mouse HRP secondary antibody using chemiluminescence.
Immunocytochemistry/Immunofluorescence: LDL R Antibody (C7) [NBP1-78159] - Image from a customer review on porcine intestinal epithelial cells IPEC-J2.
Immunohistochemistry: LDL R Antibody (C7) [NBP1-78159] - Analysis of an FFPE tissue section of human liver using LDL Receptor antibody (clone C7) with HRP-DAB based detection and hematoxylin counterstaining.
(1 Review)
(18 Publications)
Species: Hu, Rt, Po, Bv
Applications: WB, EM, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vitro, RIA
SREBP1 Antibody
(2A4)
NB600-582
Western Blot: SREBP1 Antibody (2A4) [NB600-582] - Analysis of whole cell lysate from HeLa cells showing a single specific band for the expression of SREBP1 precursor protein (~120 kDa).
Simple Western: SREBP1 Antibody (2A4) [NB600-582] - Lane view shows a specific band for SREBP1 in 1.0 mg/ml of HeLa lysate. This experiment was performed under reducing conditions using the 12-230 kDa separation system.
(35 Publications)
Species: Hu, Mu, Rt, Ca, Ch, SyHa, Ha, Mk
Applications: WB, Simple Western, IHC
SREBP2 Antibody
(1D2)
NBP1-54446
Western Blot: SREBP2 Antibody (1D2) [NBP1-54446] - Lane1: HEp-2 cells. Lane 2: MCF-7 cells. Lane 3: LNCaP cells. Lane 4: HT1080 cells. Lane 5: ZR75-1 cells.
Immunocytochemistry/Immunofluorescence: SREBP2 Antibody (1D2) [NBP1-54446] - SREBP2 (1D2) antibody was tested in HeLa cells with DyLight 488 (green). Nuclei and alpha-tubulin were counterstained with DAPI (blue) and DyLight 550 (red).
(14 Publications)
Species: Hu, Ch
Applications: WB, ELISA, GS, ICC/IF, IP
MVK Antibody
[Unconjugated]
AF8516
Western blot shows lysates of HepG2 human hepatocellular carcinoma cell line, A431 human epithelial carcinoma cell line, and HEK001 human epidermal keratinocyte cell line. PVDF membrane was probed with 0.1 µg/mL of Rabbit Anti-Human MVK Antigen Affinity-purified Polyclonal Antibody (Catalog # AF8516) followed by HRP-conjugated Anti-Rabbit IgG Secondary Antibody (Catalog # HAF008). A specific band was detected for MVK at approximately 42 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
MVK was detected in immersion fixed A431 human epithelial carcinoma cell line using Rabbit Anti-Human MVK Antigen Affinity-purified Polyclonal Antibody (Catalog # AF8516) at 2 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Rabbit IgG Secondary Antibody (red; Catalog # NL004) and counterstained with DAPI (blue). Specific staining was localized to cytoplasm. View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
MVK was immunoprecipitated from 400 µg of HepG2 human hepatocellular carcinoma cell line and A431 human epithelial carcinoma cell line lysates using 4 µg of Rabbit Anti-Human MVK Antigen Affinity-purified Polyclonal Antibody (Catalog # AF8516) coated on 4 wells of a 96 well plate (Corning Costar EIA/RIA). HepG2 lysates, A431 lysates, Rabbit IgG control buffer, or recombinant human MVK were added to the wells and incubated for 2 hours at room temperature. Immunoprecipitated MVK was detected by Western blot under reducing conditions using 0.1 µg/mL Rabbit Anti-Human MVK Antigen Affinity-purified Polyclonal Antibody (Catalog # AF8516) and Immunoblot Buffer Group 1. View our recommended buffer recipes for Immunoprecipitation.
Species: Hu
Applications: WB, Simple Western, IP, ICC
Mouse Complement
C4 ELISA Kit (Colorim ...
NBP2-70040
Mouse Complement C4 ELISA Kit (Colorimetric) - Standard Curve Reference
Species: Mu
LSS Antibody
NBP1-53166
Western Blot: LSS Antibody [NBP1-53166] - Human Liver cell lysate, concentration 0.2-1 ug/ml.
Immunohistochemistry: LSS Antibody [NBP1-53166] - Formalin Fixed Paraffin Embedded Tissue: Human heart Tissue Observed Staining: Cytoplasmic Primary Antibody Concentration: N/A Other Working Concentrations: 1:600 Secondary Antibody: Donkey anti-Rabbit-Cy3 Secondary Antibody Concentration: 1:200 Magnification: 20X Exposure Time: 0.5 - 2.0 sec
Species: Hu, Mu, Rt, Bv, Ca, Eq, GP, Rb, Ze
Applications: WB, IHC
Mouse Complement
C4 ELISA Kit (Colorim ...
NBP2-70040
Mouse Complement C4 ELISA Kit (Colorimetric) - Standard Curve Reference
Species: Mu
SGPL1 Antibody
[Unconjugated]
AF5535
Western blot shows lysates of HEK293 human embryonic kidney cell line, HepG2 human hepatocellular carcinoma cell line, HT‑29 human colon adenocarcinoma cell line, and HT‑29 tumor tissue. PVDF membrane was probed with 1 µg/mL of Goat Anti-Human SGPL1 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF5535) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF019). A specific band was detected for SGPL1 at approximately 60 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 8.
Simple Western lane view shows lysates of HEK293 human embryonic kidney cell line and HepG2 human hepatocellular carcinoma cell line, loaded at 0.2 mg/mL. A specific band was detected for SGPL1 at approximately 60 kDa (as indicated) using 50 µg/mL of Goat Anti-Human SGPL1 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF5535) followed by 1:50 dilution of HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF109). This experiment was conducted under reducing conditions and using the12-230 kDa separation system.
(4 Publications)
Species: Hu
Applications: WB, Simple Western
SP1 Antibody
NB600-233
Western Blot: SP1 Antibody [NB600-233] - Samples: Whole cell lysate (50 ug) from HeLa, 293T, and mouse Renca cells prepared using NETN lysis buffer. Antibody: Affinity purified rabbit anti-SP1 antibody used for WB at 0.1 ug/ml. Detection: Chemiluminescence with an exposure time of 10 seconds.
Immunohistochemistry-Paraffin: SP1 Antibody [NB600-233] - Mouse renal cell carcinoma. Antibody: Affinity purified rabbit anti-SP1 used at a dilution of 1:5,000 (0.2ug/ml). Detection: DAB
Chromatin Immunoprecipitation: SP1 Antibody [NB600-233] - Chromatin from acute myeloid leukemia cell line was immunoprecipitated with anti-Sp1 antibody and analyzed by DNA sequencing. The figure illustrates the peak distribution of Sp1 binding within a 250 Kb region of chromosome 6 asdetected using anti-Sp1.
(4 Publications)
Species: Hu, Mu
Applications: WB, ChIP, IHC, IHC-P, IP, CHIP-SEQ
Complement C3
Antibody (11H9)
NB200-540
Flow (Intracellular): Complement C3 Antibody (11H9) [NB200-540] - An intracellular stain was performed on RAW 246.7 cells with Complement C3 (11H9-3-2) antibody NB200-540 (blue) and a matched isotype control NBP2-31382 (orange). Cells were either treated with 3uM Monensin for 3 hours to block the secretion of Complement C3 (B) or grown in normal media (A). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 2 ug/mL for 30 minutes at room temperature, followed by mouse F(ab)2 IgG (H+L) PE-conjugated secondary antibody (F0102B, R&D Systems).
Immunocytochemistry/Immunofluorescence: Complement C3 Antibody (11H9) [NB200-540] - C3 protein fragments deposited on kidney cells of MPL-lpr mouse. Staining with antibody 11H9. Glomerular staining pattern. Fixation in 4% paraformaldehyde in PBS pH 7.4. Vibratome sections of 4 um. Pretreated with 3% hydrogen peroxide for 20 min to quench endogenous peroxidases. Microwaved in antigen unmasking solution for 2-5 minutes as antigen retrieval.
Immunohistochemistry-Paraffin: Complement C3 Antibody (11H9) [NB200-540] - Complement C3 protein in a FFPE tissue section of mouse liver using 1:100 dilution of Complement C3 antibody (clone 11H9) NB200-540. Weak but distinct membrane-cytoplasmic immunopositivity was observed in hepatocytes and few cells developed punctate membrane staining.
(2 Reviews)
(3 Publications)
Species: Mu
Applications: Flow, IA, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
COCO/DAND5
[Unconjugated]
3047-CC
COCO/DAND5 [Unconjugated]
(1 Publication)
Species: Hu

Publications for FDFT1 Antibody (NBP1-89560)(1)


Reviews for FDFT1 Antibody (NBP1-89560) (0)

There are no reviews for FDFT1 Antibody (NBP1-89560). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for FDFT1 Antibody (NBP1-89560) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Control Lysate(s)

FDFT1 Knockout 293T Cell Lysate

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Learn about Custom Antibody Labeling

Additional FDFT1 Products

Bioinformatics Tool for FDFT1 Antibody (NBP1-89560)

Discover related pathways, diseases and genes to FDFT1 Antibody (NBP1-89560). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for FDFT1 Antibody (NBP1-89560)

Discover more about diseases related to FDFT1 Antibody (NBP1-89560).
 

Pathways for FDFT1 Antibody (NBP1-89560)

View related products by pathway.

PTMs for FDFT1 Antibody (NBP1-89560)

Learn more about PTMs related to FDFT1 Antibody (NBP1-89560).

Blogs on FDFT1

There are no specific blogs for FDFT1, but you can read our latest blog posts.
Recombinant Monoclonal Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our FDFT1 Antibody and receive a gift card or discount.


Bioinformatics

Gene Symbol FDFT1