Home » FDFT1 » FDFT1 Research Products » FDFT1 Antibody

FDFT1 Antibody

 (1 Publication)
 See All Related
Submit a Review

Images

 
(
Enlarge)
Western Blot: FDFT1 Antibody [NBP1-89560] - Analysis in mouse cell line NIH-3T3.
Western Blot: FDFT1 Antibody [NBP1-89560] - Analysis in mouse cell line NIH-3T3.
Immunocytochemistry/ Immunofluorescence: FDFT1 Antibody [NBP1-89560] - Staining of human cell line U-2 OS shows localization to endoplasmic reticulum. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: FDFT1 Antibody [NBP1-89560] - Staining of human testis shows strong cytoplasmic positivity in Leydig cells.
Western Blot: FDFT1 Antibody [NBP1-89560] - Analysis in human cell line HEK 293.
Western Blot: FDFT1 Antibody [NBP1-89560] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
Immunohistochemistry-Paraffin: FDFT1 Antibody [NBP1-89560] - Staining of human duodenum shows weak to moderate cytoplasmic/ membranous positivity in glandular cells.
Immunohistochemistry-Paraffin: FDFT1 Antibody [NBP1-89560] - Staining of human pancreas shows no positivity in exocrine glandular cells as expected.
Immunohistochemistry-Paraffin: FDFT1 Antibody [NBP1-89560] - Staining of human prostate shows moderate cytoplasmic positivity in smooth muscle cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

FDFT1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: PEEFYNLVRFRIGGKRKVMPKMDQDSLSSSLKTCYKYLNQTSRSFAAVIQALDGEMRNAVCIFYLVLRALDTLEDDMTISVEKKVPLLHNFHSFLYQPDWRFMESKEKDRQVLEDFPTISLEFRNLAEKYQTVIADICR
Specificity
Specificity of human, mouse, rat FDFT1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
FDFT1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control
FDFT1 Knockout 293T Cell Lysate
Control Peptide
FDFT1 Protein (NBP1-89560PEP)
Publications
Read Publication using NBP1-89560.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for FDFT1 Antibody

  • DGPT
  • EC 2.5.1.21
  • ERG9
  • farnesyl-diphosphate farnesyltransferase 1
  • Farnesyl-diphosphate farnesyltransferase
  • FPP:FPP farnesyltransferase
  • presqualene-di-diphosphate synthase
  • SQS
  • squalene synthase
  • squalene synthetase
  • SS

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

FDPS Antibody
NBP2-16463
Western Blot: FDPS Antibody [NBP2-16463] - Various whole cell extracts (30 ug) were separated by 10% SDS-PAGE, and the membrane was blotted with FDPS antibody [N1C3] diluted at 1:3000. The HRP-conjugated anti-rabbit IgG antibody (NBP2-19301) was used to detect the primary antibody.
Immunocytochemistry/Immunofluorescence: FDPS Antibody [NBP2-16463] - HeLa cells were fixed in ice-cold MeOH for 5 min. Green: FDPS protein stained by FDPS antibody [N1C3] diluted at 1:500. Blue: Hoechst 33342 staining. Scale bar = 10 um.
Immunohistochemistry-Paraffin: FDPS Antibody [NBP2-16463] - Mouse kidney. FDPS stained by FDPS antibody [N1C3] diluted at 1:500. Antigen Retrieval: Citrate buffer, pH 6.0, 15 min.
(1 Review)
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
HMG-CoA
Reductase/HMGCR Antib ...
NBP2-66888
Simple Western: HMG-CoA Reductase/HMGCR Antibody (JF0981) [NBP2-66888] - SVG-A whole cell lysate. Antibody at 1:25 dilution. Image from verified customer review.
HMG-CoA Reductase/HMGCR Antibody (JF0981) [NBP2-66888] - Analysis of HMGCR on different lysates. Proteins were transferred to a PVDF membrane and blocked with 5% BSA in PBS for 1 hour at room temperature. The primary antibody (ET1702-41, 1/500) was used in 5% BSA at room temperature for 2 hours. Goat Anti-Rabbit IgG - HRP Secondary Antibody (HA1001) at 1:5,000 dilution was used for 1 hour at room temperature.Positive control: Lane 1: Hela cell lysateLane 2: THP-1 cell lysate
(1 Review)
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IP
SQLE Antibody
NBP2-32001
Immunohistochemistry-Paraffin: SQLE Antibody [NBP2-32001] - Staining of human skin shows moderate cytoplasmic positivity in squamous epithelial cells.
Immunohistochemistry-Paraffin: SQLE Antibody [NBP2-32001] - Staining of human colon shows moderate cytoplasmic positivity in myocytes.
Immunohistochemistry-Paraffin: SQLE Antibody [NBP2-32001] - Staining of human placenta shows moderate cytoplasmic positivity in trophoblastic cells.
(1 Publication)
Species: Hu, Mu
Applications: WB, IHC, IHC-P
GGPS1 Antibody
NBP1-83368
Western Blot: GGPS1 Antibody [NBP1-83368] - Analysis in control (vector only transfected HEK293T lysate) and GGPS1 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
Immunohistochemistry-Paraffin: GGPS1 Antibody [NBP1-83368] - Staining of human liver shows no positivity in hepatocytes as expected.
Western Blot: GGPS1 Antibody [NBP1-83368] - Analysis in human cell line RT-4.
Species: Hu
Applications: WB, IHC, IHC-P
MSX2 Antibody
NBP1-85445
Immunohistochemistry-Paraffin: MSX2 Antibody [NBP1-85445] - Staining of human placenta shows strong nuclear positivity in trophoblastic cells.
Immunohistochemistry-Paraffin: MSX2 Antibody [NBP1-85445] - Staining of human urinary bladder shows weak nuclear positivity in urothelial cells.
Immunohistochemistry-Paraffin: MSX2 Antibody [NBP1-85445] - Staining of human endometrium shows moderate nuclear positivity in glandular cells.
(3 Publications)
Species: Hu
Applications: WB, IHC, IHC-P
Glycophorin A
Antibody (R10) [Uncon ...
MAB1228
Glycophorin A was detected in immersion fixed paraffin-embedded sections of human lung using Mouse Anti-Human Glycophorin A Monoclonal Antibody (Catalog # MAB1228) at 1.7 µg/mL overnight at 4 °C. Tissue was stained using the Anti-Mouse HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS002) and counterstained with hematoxylin (blue). Specific staining was localized to cell membranes of red blood cells. View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
TF‑1 human erythroleukemic cell line was stained with Mouse Anti-Human Glycophorin A Monoclonal Antibody (Catalog # MAB1228, filled histogram) or isotype control antibody (Catalog # MAB002, open histogram), followed by Phycoerythrin-conjugated Anti-Mouse IgG Secondary Antibody (Catalog # F0102B).
(2 Publications)
Species: Hu
Applications: Flow, IHC, IP, CyTOF-ready
Carbonic Anhydrase
IX/CA9 Antibody
NB100-417
Immunohistochemistry: Carbonic Anhydrase IX/CA9 Antibody [NB100-417] - Images showing Carbonic Anhydrase IX/CA9 expression, pimonidazole, apoptosis and proliferation in SCCNij202.Carbonic Anhydrase IX/CA9 is expressed in hypoxic regions as assessed by pimonidazole staining (A), but is also observed in non-pimonidazole areas (B). Yet, most of Carbonic Anhydrase IX/CA9 is expressed in pimonidazole positive regions (C). Proliferation (BrdUrd) and apoptosis (caspase-3) in relation to Carbonic Anhydrase IX/CA9 expression are shown in figure D and E. Red, Carbonic Anhydrase IX/CA9; Green, pimonidazole (A-B), BrdUrd (D) or caspase-3 (E); Yellow, overlap of Carbonic Anhydrase IX/CA9 (red) and pimonidazole (green); Light blue, vessels. Magnification 100x. Scale bars represent 100 um. Closed circles represent Carbonic Anhydrase IX/CA9 expression in pimonidazole positive regions; open circles represent Carbonic Anhydrase IX/CA9 expression in pimonidazole negative regions. Image collected and cropped by CiteAb from the following publication (http://dx.plos.org/10.1371/journal.pone.0108068), licensed under a CC-BY licence.
Dual RNAscope ISH-IHC: Carbonic Anhydrase IX/CA9 Antibody [NB100-417] - Formalin-fixed paraffin-embedded tissue sections of human stomach were probed for Carbonic Anhydrase IX/CA9 mRNA (ACD RNAScope Probe, catalog # 559348; Fast Red chromogen, ACD catalog # 322750). Adjacent tissue section was processed for immunohistochemistry using Rabbit Polyclonal (Novus catalog # NB100-417) at 1:1000 dilution with overnight incubation at 4 degrees Celsius followed by incubation with anti-rabbit IgG VisUCyte HRP Polymer Antibody (Catalog # VC003) and DAB chromogen (yellow-brown). Tissue was counterstained with hematoxylin (blue). Specific staining was localized to glandular cells.
Western Blot: Carbonic Anhydrase IX/CA9 Antibody [NB100-417] - Analysis on various human cell lysates. Specific bands were detected for Carbonic Anhydrase IX/CA9 in HEK-293 and A498 cell lines at a molecular weight of approximately 50 kDa. WB image submitted by a verified customer review.
(6 Reviews)
(200 Publications)
Species: Hu, Mu, Rt, Pl
Applications: WB, Simple Western, ChIP, ELISA, Flow, GS, IB, ICC/IF, IHC, IHC-Fr, IHC-P, MiAr, Dual ISH-IHC, KO
LDLR Antibody (C7)
NBP1-78159
Western Blot: LDL R Antibody (C7) [NBP1-78159] - Total protein from human HeLa and HepG2 cells was separated on a 7.5% gel by SDS-PAGE, transferred to PVDF membrane and blocked in 5% non-fat milk in TBST. The membrane was probed with 0.5 ug/mL anti-LDL receptor in 1% non-fat milk in TBST and detected with an anti-mouse HRP secondary antibody using chemiluminescence.
Immunocytochemistry/Immunofluorescence: LDL R Antibody (C7) [NBP1-78159] - Image from a customer review on porcine intestinal epithelial cells IPEC-J2.
Immunohistochemistry: LDL R Antibody (C7) [NBP1-78159] - Analysis of an FFPE tissue section of human liver using LDL Receptor antibody (clone C7) with HRP-DAB based detection and hematoxylin counterstaining.
(1 Review)
(20 Publications)
Species: Hu, Rt, Po, Bv
Applications: WB, EM, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vitro, PLA, RIA
SREBP1 Antibody
(2A4)
NB600-582
Western Blot: SREBP1 Antibody (2A4) [NB600-582] - Hepatic SREBP1c and SREBP2 protein abundance in C57BL/6 mice assigned to a high-fat (HF) or a high-fat/exercise (HF + EX) group for 8 weeks. Cytosolic and nuclear SREBP1c abundance. Image collected and cropped by CiteAb from the following publication (http://www.hindawi.com/journals/jl/2013/908048/), licensed under a CC-BY licence.
Western Blot: SREBP1 Antibody (2A4) [NB600-582] - Analysis of whole cell lysate from HeLa cells showing a single specific band for the expression of SREBP1 precursor protein (~120 kDa).
Simple Western: SREBP1 Antibody (2A4) [NB600-582] - Lane view shows a specific band for SREBP1 in 1.0 mg/ml of HeLa lysate. This experiment was performed under reducing conditions using the 12-230 kDa separation system.
(38 Publications)
Species: Hu, Mu, Rt, Ca, Ch, SyHa, Ha, Pm
Applications: WB, Simple Western, IHC, KO
SREBP2 Antibody
(1D2)
NBP1-54446
Western Blot: SREBP2 Antibody (1D2) [NBP1-54446] - Lane1: HEp-2 cells. Lane 2: MCF-7 cells. Lane 3: LNCaP cells. Lane 4: HT1080 cells. Lane 5: ZR75-1 cells.
Immunocytochemistry/Immunofluorescence: SREBP2 Antibody (1D2) [NBP1-54446] - SREBP2 (1D2) antibody was tested in HeLa cells with DyLight 488 (green). Nuclei and alpha-tubulin were counterstained with DAPI (blue) and DyLight 550 (red).
(15 Publications)
Species: Hu, Ch
Applications: WB, ELISA, GS, ICC/IF, IP
MVK Antibody
[Unconjugated]
AF8516
Western blot shows lysates of HepG2 human hepatocellular carcinoma cell line, A431 human epithelial carcinoma cell line, and HEK001 human epidermal keratinocyte cell line. PVDF membrane was probed with 0.1 µg/mL of Rabbit Anti-Human MVK Antigen Affinity-purified Polyclonal Antibody (Catalog # AF8516) followed by HRP-conjugated Anti-Rabbit IgG Secondary Antibody (Catalog # HAF008). A specific band was detected for MVK at approximately 42 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
MVK was detected in immersion fixed A431 human epithelial carcinoma cell line using Rabbit Anti-Human MVK Antigen Affinity-purified Polyclonal Antibody (Catalog # AF8516) at 2 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Rabbit IgG Secondary Antibody (red; Catalog # NL004) and counterstained with DAPI (blue). Specific staining was localized to cytoplasm. View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
MVK was immunoprecipitated from 400 µg of HepG2 human hepatocellular carcinoma cell line and A431 human epithelial carcinoma cell line lysates using 4 µg of Rabbit Anti-Human MVK Antigen Affinity-purified Polyclonal Antibody (Catalog # AF8516) coated on 4 wells of a 96 well plate (Corning Costar EIA/RIA). HepG2 lysates, A431 lysates, Rabbit IgG control buffer, or recombinant human MVK were added to the wells and incubated for 2 hours at room temperature. Immunoprecipitated MVK was detected by Western blot under reducing conditions using 0.1 µg/mL Rabbit Anti-Human MVK Antigen Affinity-purified Polyclonal Antibody (Catalog # AF8516) and Immunoblot Buffer Group 1. View our recommended buffer recipes for Immunoprecipitation.
Species: Hu
Applications: WB, Simple Western, IP, ICC
Mouse Complement
C4 ELISA Kit (Colorim ...
NBP2-70040
Mouse Complement C4 ELISA Kit (Colorimetric) - Standard Curve Reference
Species: Mu
LSS Antibody
NBP2-17184
Western Blot: LSS Antibody [NBP2-17184] - Sample (30 ug of whole cell lysate) A: U87-MG 7. 5% SDS PAGE gel, diluted at 1:1000.
Immunohistochemistry-Paraffin: LSS Antibody [NBP2-17184] - Immunohistochemical analysis of paraffin-embedded Hepatoma, using antibody at 1:500 dilution.
Species: Hu
Applications: WB, IHC, IHC-P
Mouse Complement
C4 ELISA Kit (Colorim ...
NBP2-70040
Mouse Complement C4 ELISA Kit (Colorimetric) - Standard Curve Reference
Species: Mu
SGPL1 Antibody
[Unconjugated]
AF5535
Western blot shows lysates of HEK293 human embryonic kidney cell line, HepG2 human hepatocellular carcinoma cell line, HT‑29 human colon adenocarcinoma cell line, and HT‑29 tumor tissue. PVDF membrane was probed with 1 µg/mL of Goat Anti-Human SGPL1 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF5535) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF019). A specific band was detected for SGPL1 at approximately 60 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 8.
Simple Western lane view shows lysates of HEK293 human embryonic kidney cell line and HepG2 human hepatocellular carcinoma cell line, loaded at 0.2 mg/mL. A specific band was detected for SGPL1 at approximately 60 kDa (as indicated) using 50 µg/mL of Goat Anti-Human SGPL1 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF5535) followed by 1:50 dilution of HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF109). This experiment was conducted under reducing conditions and using the12-230 kDa separation system.
(5 Publications)
Species: Hu
Applications: WB, Simple Western
SP1 Antibody
NB600-233
Western Blot: SP1 Antibody [NB600-233] - Samples: Whole cell lysate (50 ug) from HeLa, 293T, and mouse Renca cells prepared using NETN lysis buffer. Antibody: Affinity purified rabbit anti-SP1 antibody used for WB at 0.1 ug/ml. Detection: Chemiluminescence with an exposure time of 10 seconds.
Immunohistochemistry-Paraffin: SP1 Antibody [NB600-233] - Mouse renal cell carcinoma. Antibody: Affinity purified rabbit anti-SP1 used at a dilution of 1:5,000 (0.2ug/ml). Detection: DAB
Chromatin Immunoprecipitation: SP1 Antibody [NB600-233] - Chromatin from acute myeloid leukemia cell line was immunoprecipitated with anti-Sp1 antibody and analyzed by DNA sequencing. The figure illustrates the peak distribution of Sp1 binding within a 250 Kb region of chromosome 6 asdetected using anti-Sp1.
(4 Publications)
Species: Hu, Mu
Applications: WB, ChIP, IHC, IHC-P, IP, CHIP-SEQ
Complement C3
Antibody (11H9)
NB200-540
Flow (Intracellular): Complement C3 Antibody (11H9) [NB200-540] - An intracellular stain was performed on RAW 246.7 cells with Complement C3 (11H9-3-2) antibody NB200-540 (blue) and a matched isotype control NBP2-31382 (orange). Cells were either treated with 3uM Monensin for 3 hours to block the secretion of Complement C3 (B) or grown in normal media (A). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 2 ug/mL for 30 minutes at room temperature, followed by mouse F(ab)2 IgG (H+L) PE-conjugated secondary antibody (F0102B, R&D Systems).
Immunocytochemistry/Immunofluorescence: Complement C3 Antibody (11H9) [NB200-540] - C3 protein fragments deposited on kidney cells of MPL-lpr mouse. Staining with antibody 11H9. Glomerular staining pattern. Fixation in 4% paraformaldehyde in PBS pH 7.4. Vibratome sections of 4 um. Pretreated with 3% hydrogen peroxide for 20 min to quench endogenous peroxidases. Microwaved in antigen unmasking solution for 2-5 minutes as antigen retrieval.
Immunohistochemistry-Paraffin: Complement C3 Antibody (11H9) [NB200-540] - Complement C3 protein in a FFPE tissue section of mouse liver using 1:100 dilution of Complement C3 antibody (clone 11H9) NB200-540. Weak but distinct membrane-cytoplasmic immunopositivity was observed in hepatocytes and few cells developed punctate membrane staining.
(2 Reviews)
(9 Publications)
Species: Mu
Applications: Flow, IA, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
PSG1 [HRP]
DPSG10
(2 Publications)
Species: Hu
COCO/DAND5
Antibody (OTI2H3)
NBP2-01223
Western Blot: DAND5 Antibody (2H3) [NBP2-01223] - HEK293T cells were transfected with the pCMV6-ENTRY control (Left lane) or pCMV6-ENTRY DAND5 (Right lane) cDNA for 48 hrs and lysed. Equivalent amounts of cell lysates (5 ug per lane) were separated by SDS-PAGE and immunoblotted with anti-DAND5.
Immunohistochemistry-Paraffin: DAND5 Antibody (2H3) [NBP2-01223] Staining of paraffin-embedded Carcinoma of Human bladder tissue using anti-DAND5 mouse monoclonal antibody.
Flow Cytometry: DAND5 Antibody (2H3) [NBP2-01223] - HEK293T cells transfected with either overexpression plasmid (Red) or empty vector control plasmid (Blue) were immunostained by anti-DAND5 antibody, and then analyzed by flow cytometry.
Species: Hu
Applications: WB, Flow, IHC, IHC-P
FDFT1 Antibody
NBP1-89560
FDFT1 Antibody
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for FDFT1 Antibody (NBP1-89560)(1)


Reviews for FDFT1 Antibody (NBP1-89560) (0)

There are no reviews for FDFT1 Antibody (NBP1-89560). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for FDFT1 Antibody (NBP1-89560) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Control Lysate(s)

FDFT1 Knockout 293T Cell Lysate

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Learn about Custom Antibody Labeling

Additional FDFT1 Products

Bioinformatics Tool for FDFT1 Antibody (NBP1-89560)

Discover related pathways, diseases and genes to FDFT1 Antibody (NBP1-89560). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for FDFT1 Antibody (NBP1-89560)

Discover more about diseases related to FDFT1 Antibody (NBP1-89560).
 

Pathways for FDFT1 Antibody (NBP1-89560)

View related products by pathway.

PTMs for FDFT1 Antibody (NBP1-89560)

Learn more about PTMs related to FDFT1 Antibody (NBP1-89560).

Blogs on FDFT1

There are no specific blogs for FDFT1, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our FDFT1 Antibody and receive a gift card or discount.


Bioinformatics

Gene Symbol FDFT1