FDFT1 Antibody

Images

 
Western Blot: FDFT1 Antibody [NBP1-54855] - Jurkat cell lysate, concentration 2.5 ug/ml.

Product Details

Summary
Reactivity Hu, Mu, Rt, Po, Bv, Ca, Eq, GP, Rb, ZeSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

FDFT1 Antibody Summary

Immunogen
Synthetic peptide directed towards the N terminal of human FDFT1 (NP_004453). Peptide sequence HSFLYQPDWRFMESKEKDRQVLEDFPTISLEFRNLAEKYQTVIADICRRM.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
FDFT1
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 2.5 ug/ml
Application Notes
This is a rabbit polyclonal antibody against FDFT1 and was validated on Western blot.
Theoretical MW
48 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Control
FDFT1 Knockout 293T Cell Lysate
Publications
Read Publication using
NBP1-54855 in the following applications:

  • WB
    1 publication

Reactivity Notes

Bovine reactivity reported in scientific literature (PMID: 26673142)

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Protein A purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for FDFT1 Antibody

  • DGPT
  • EC 2.5.1.21
  • ERG9
  • farnesyl-diphosphate farnesyltransferase 1
  • Farnesyl-diphosphate farnesyltransferase
  • FPP:FPP farnesyltransferase
  • presqualene-di-diphosphate synthase
  • SQS
  • squalene synthase
  • squalene synthetase
  • SS

Background

FDFT1 is a membrane-associated enzyme located at a branch point in the mevalonate pathway. The protein is the first specific enzyme in cholesterol biosynthesis, catalyzing the dimerization of two molecules of farnesyl diphosphate in a two-step reaction to form squalene.This gene encodes a membrane-associated enzyme located at a branch point in the mevalonate pathway. The encoded protein is the first specific enzyme in cholesterol biosynthesis, catalyzing the dimerization of two molecules of farnesyl diphosphate in a two-step reaction to form squalene. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-16463
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP2-66888
Species: Hu, Mu, Rt
Applications: WB, ChIP, IP
NBP2-32001
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-83368
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-85445
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
MAB1228
Species: Hu
Applications: Flow, IHC, IP, CyTOF-ready
NB100-417
Species: Hu, Mu, Rt, Pl
Applications: WB, Simple Western, ChIP, ELISA, Flow, GS, IB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-78159
Species: Hu, Rt, Po, Bv
Applications: WB, EM, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vitro, RIA
NB600-582
Species: Hu, Mu, Rt, Ca, Ch, SyHa, Ha, Mk
Applications: WB, Simple Western, IHC
NBP1-54446
Species: Hu, Ch
Applications: WB, ELISA, GS, ICC/IF, IP
AF8516
Species: Hu
Applications: WB, Simple Western, IP, ICC
NBP1-53166
Species: Hu, Mu, Rt, Bv, Ca, Eq, GP, Rb, Ze
Applications: WB, IHC
AF5535
Species: Hu
Applications: WB, Simple Western
NB600-233
Species: Hu, Mu
Applications: WB, ChIP, IHC, IHC-P, IP, CHIP-SEQ
NB200-540
Species: Mu
Applications: Flow, IA, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC

Publications for FDFT1 Antibody (NBP1-54855)(1)

We have publications tested in 1 confirmed species: Bovine.

We have publications tested in 1 application: WB.


Filter By Application
WB
(1)
All Applications
Filter By Species
Bovine
(1)
All Species

Reviews for FDFT1 Antibody (NBP1-54855) (0)

There are no reviews for FDFT1 Antibody (NBP1-54855). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for FDFT1 Antibody (NBP1-54855) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Control Lysate(s)

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional FDFT1 Products

Bioinformatics Tool for FDFT1 Antibody (NBP1-54855)

Discover related pathways, diseases and genes to FDFT1 Antibody (NBP1-54855). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for FDFT1 Antibody (NBP1-54855)

Discover more about diseases related to FDFT1 Antibody (NBP1-54855).
 

Pathways for FDFT1 Antibody (NBP1-54855)

View related products by pathway.

PTMs for FDFT1 Antibody (NBP1-54855)

Learn more about PTMs related to FDFT1 Antibody (NBP1-54855).

Blogs on FDFT1

There are no specific blogs for FDFT1, but you can read our latest blog posts.
Recombinant Monoclonal Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our FDFT1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol FDFT1
Entrez
Uniprot