Recombinant Human Fc gamma RIIA/CD32a Protein

Product Discontinued

Recombinant Human Fc gamma RIIA/CD32a Protein Summary

• Description: A recombinant protein with a N-terminal GST tag corresponding to the amino acids 1-105 of Human FCGR2A partial ORF
  
  

  Source: Wheat Germ (in vitro)

  Amino Acid Sequence:PPWINVLQEDSVTLTCQGARSPESDSIQWFHNGNLIPTHTQPSYRFKANNNDSGEYTCQTGQTSLSDPVHLTVLSEWLVLQTPHLEFQEGETIMLRCHSWKDKPL

• Protein/Peptide Type: Partial Recombinant Protein
• Gene: FCGR2A

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • Western Blot
• Application Notes: Useful in Western Blot and ELISA. This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Reactivity Notes

Human

Packaging, Storage & Formulations

• Storage: Store at -80C. Avoid freeze-thaw cycles.
• Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Fc gamma RIIA/CD32a Protein

• CD32 antigen
• CD32a
• CD32MGC23887
• CDw32fc-gamma-RIIa
• Fc fragment of IgG, low affinity IIa, receptor (CD32)
• Fc fragment of IgG, low affinity IIa, receptor for (CD32)
• Fc gamma RIIA
• FCG2
• Fc-gamma RII-a
• Fc-gamma-RIIa
• FcGR
• FCGR2
• FCGR2A
• FCGR2A1
• FcgRIIA
• FCRIIA
• fcRII-a
• IGFR2MGC30032
• IgG Fc receptor II-a
• Immunoglobulin G Fc receptor II
• low affinity immunoglobulin gamma Fc region receptor II-a

Background

FCGR2A - Fc fragment of IgG, low affinity IIa, receptor (CD32)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

FAQs for Fc gamma RIIA/CD32a Partial Recombinant Protein (H00002212-Q01). (Showing 1 - 1 of 1 FAQ).

1. Does any of your FCGR2A antibodies (19C10, 6D11, 13G9) cross react to FCGR2B?
   • For these antibodies, we have used the full-length protein FCGR2A (NP_067674) as the immunogen and we have not mapped the epitope that is detected with each Ab yet. I did an alignment of these two proteins and they are highly conserved thus it seems likely that there will be cross-reactivity.

Bioinformatics

• Gene Symbol: FCGR2A