FBP2 Antibody

Images

 
Western Blot: FBP2 Antibody [NBP1-86473] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 10. Lane 2: Human skeletal muscle tissue.
Immunohistochemistry: FBP2 Antibody [NBP1-86473] - Staining of human liver shows cytoplasmic positivity in hepatocytes.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

FBP2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:RKAGLAHLYGIAGSVNVTGDEVKKLDVLSNSLVINMVQSSYSTCVLVSEENKDAIITAKEKRGKYVVCFDPLDG
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (91%), Rat (93%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
FBP2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
FBP2 Protein (NBP1-86473PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for FBP2 Antibody

  • D-fructose-1,6-bisphosphate 1-phosphohydrolase 2
  • EC 3.1.3
  • EC 3.1.3.11
  • FBPase 2
  • fructose-1,6-bisphosphatase 2
  • fructose-1,6-bisphosphatase isozyme 2
  • hexosediphosphatase
  • MGC142192
  • muscle fructose-bisphosphatase

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-18910
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP1-84721
Species: Hu
Applications: WB, Simple Western, IHC, IHC-P
NBP2-16543
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-16545
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-80533
Species: Mu
Applications: WB
NBP1-84720
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB400-135
Species: Hu, Mu, Rt
Applications: WB, ChIP, IB, ICC/IF, IHC, IHC-P, IP
NBP2-02164
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
MAB5646
Species: Hu
Applications: WB, Flow, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
NBP2-43654
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-65214
Species: Hu, Mu, Rt, Ma
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-47778
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB400-114
Species: Hu, Mu, Rt, Po, Ch, Ha, Pl, Pm
Applications: WB, ICC/IF, IHC, IHC-P, IP
AF6898
Species: Hu, Mu, Rt
Applications: WB
NB300-537
Species: Hu, Mu, Rt, Bv, Rb
Applications: WB, ChIP, Flow, GS, ICC/IF, IHC, IHC-P, IP
NBP1-57033
Species: Hu
Applications: WB
NBP1-71702
Species: Hu, Mu, Ch
Applications: WB, Simple Western, ChIP, ICC/IF, IHC, IHC-P, IP

Publications for FBP2 Antibody (NBP1-86473) (0)

There are no publications for FBP2 Antibody (NBP1-86473).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FBP2 Antibody (NBP1-86473) (0)

There are no reviews for FBP2 Antibody (NBP1-86473). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for FBP2 Antibody (NBP1-86473) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional FBP2 Products

Bioinformatics Tool for FBP2 Antibody (NBP1-86473)

Discover related pathways, diseases and genes to FBP2 Antibody (NBP1-86473). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for FBP2 Antibody (NBP1-86473)

Discover more about diseases related to FBP2 Antibody (NBP1-86473).
 

Pathways for FBP2 Antibody (NBP1-86473)

View related products by pathway.

PTMs for FBP2 Antibody (NBP1-86473)

Learn more about PTMs related to FBP2 Antibody (NBP1-86473).
 

Research Areas for FBP2 Antibody (NBP1-86473)

Find related products by research area.

Blogs on FBP2

There are no specific blogs for FBP2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our FBP2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol FBP2