FATE1 Antibody - BSA Free

Immunohistochemistry-Paraffin: FATE1 Antibody [NBP1-85402] - Staining in human testis and endometrium tissues using anti-FATE1 antibody. Corresponding FATE1 RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: FATE1 Antibody [NBP1-85402] - Staining of human endometrium shows low expression as expected.

Immunohistochemistry-Paraffin: FATE1 Antibody [NBP1-85402] - Staining of human testis shows high expression.

• Reactivity: Hu
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

FATE1 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit FATE1 Antibody - BSA Free (NBP1-85402) is a polyclonal antibody validated for use in IHC and WB. Anti-FATE1 Antibody: Cited in 3 publications. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: GSQLPKPRMLRESGHGDAHLQEYAGNFQGIRFHYDRNPGTDAVAQTSLEEFNVLEMEVMRRQLYAVNRRLRALEEQGATW
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: FATE1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. Western Blot reactivity reported in (PMID: 26567849).
• Control Peptide:

  FATE1 Protein (NBP1-85402PEP)

Reactivity Notes

Reactivity reported in scientific literature (PMID: 23435261)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for FATE1 Antibody - BSA Free

• Cancer/testis antigen 43
• CT43BJ-HCC-2 antigen
• FATEfetal and adult testis expressed transcript protein
• fetal and adult testis expressed 1
• fetal and adult testis-expressed transcript protein
• Tumor antigen BJ-HCC-2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for FATE1 Antibody (NBP1-85402)(3)

Publications using NBP1-85402

• Maxfield KE, Taus PJ, Corcoran K et al. Comprehensive functional characterization of cancer-testis antigens defines obligate participation in multiple hallmarks of cancer. Nat Commun 2015-11-16 [PMID: 26567849] (WB, Human)
• Djureinovic D, Fagerberg L, Hallstrom B et al. The human testis-specific proteome defined by transcriptomics and antibody-based profiling. Mol Hum Reprod 2014-06-01 [PMID: 24598113]
• Stadler C, Rexhepaj E, Singan VR et al. Immunofluorescence and fluorescent-protein tagging show high correlation for protein localization in mammalian cells. Nat Methods 2013-04-01 [PMID: 23435261]

Bioinformatics

• Gene Symbol: FATE1