FAM64A Antibody - Azide and BSA Free

Western Blot: FAM64A Antibody [NBP3-03210] - Analysis of various lysates, using PIMREG antibody at 1:750 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Enhanced Kit. Exposure time: 30s.

• Reactivity: Hu, Mu, Rt
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: Azide and BSA Free

FAM64A Antibody - Azide and BSA Free Summary

• Description: Novus Biologicals Rabbit FAM64A Antibody - Azide and BSA Free (NBP3-03210) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-100 of human FAM64A (NP_001182157.1). MASRWQNMGTSVRRRSLQHQEQLEDSKELQPVVSHQETSVGALGSLCRQFQRRLPLRAVNLNLRAGPSWKRLETPEPGQQGLQAAARSAKSALGAVSQRI
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: PIMREG
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1:500 - 1:1000

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.05% Proclin 300
• Purity: Affinity purified

Alternate Names for FAM64A Antibody - Azide and BSA Free

• family with sequence similarity 64, member A
• FLJ10156
• FLJ10491
• RCS1
• regulator of chromosome segregation 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: PIMREG