Recombinant Human SLC6A20 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human SLC6A20 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 301-369 of Human SLC6A20 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:KATFNYENCLKKVSLLLTNTFDLEDGFLTASNLEQVKGYLASAYPSKYSEMFPQIKNCSLESELDTAVQ

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
SLC6A20

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human SLC6A20 Protein

  • MGC161475
  • neurotransmitter transporter RB21A
  • SIT1
  • sodium- and chloride-dependent transporter XTRP3
  • Sodium/imino-acid transporter 1
  • solute carrier family 6 (neurotransmitter transporter), member 20
  • solute carrier family 6 (proline IMINO transporter), member 20
  • Solute carrier family 6 member 20
  • Transporter rB21A homolog
  • X transporter protein 3
  • XT3orphan transporter XT3
  • Xtrp3

Background

SLC6A20 - solute carrier family 6 (proline IMINO transporter), member 20

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-86277
Species: Hu
Applications: IHC, IHC-P
NBP1-77078
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-59882
Species: Hu
Applications: WB, IHC
NB100-104
Species: Hu, Mu
Applications: WB, ELISA, Flow, IB, ICC/IF, IHC, IHC-P, IP
NBP1-82024
Species: Hu
Applications: IHC, IHC-P
NBP1-33208
Species: Hu
Applications: WB, ICC/IF
NBP1-89327
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-30037
Species: Hu
Applications: WB, Flow, ICC/IF, IHC-P, ICC
NBP2-14003
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-87216
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF933
Species: Hu
Applications: WB, Simple Western, IHC, IP
H00022908-D01P
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP2-20338
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-92409
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00054585-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-15432
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF4965
Species: Mu
Applications: WB, Simple Western, IHC
H00054716-Q01
Species: Hu
Applications: WB, ELISA, PA

Publications for SLC6A20 Partial Recombinant Protein (H00054716-Q01) (0)

There are no publications for SLC6A20 Partial Recombinant Protein (H00054716-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SLC6A20 Partial Recombinant Protein (H00054716-Q01) (0)

There are no reviews for SLC6A20 Partial Recombinant Protein (H00054716-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SLC6A20 Partial Recombinant Protein (H00054716-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional SLC6A20 Products

Bioinformatics Tool for SLC6A20 Partial Recombinant Protein (H00054716-Q01)

Discover related pathways, diseases and genes to SLC6A20 Partial Recombinant Protein (H00054716-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SLC6A20 Partial Recombinant Protein (H00054716-Q01)

Discover more about diseases related to SLC6A20 Partial Recombinant Protein (H00054716-Q01).
 

Pathways for SLC6A20 Partial Recombinant Protein (H00054716-Q01)

View related products by pathway.

PTMs for SLC6A20 Partial Recombinant Protein (H00054716-Q01)

Learn more about PTMs related to SLC6A20 Partial Recombinant Protein (H00054716-Q01).

Blogs on SLC6A20

There are no specific blogs for SLC6A20, but you can read our latest blog posts.

Customers Who Bought This Also Bought

ATM Antibody
NB100-104

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human SLC6A20 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol SLC6A20