FAM64A Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: FAM64A Antibody [NBP2-14002] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleus.
Immunohistochemistry-Paraffin: FAM64A Antibody [NBP2-14002] - Staining of human pancreas shows strong cytoplasmic positivity in exocrine glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

FAM64A Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: VETQVKARRRKRGAQKGSGSPTHSLSQKSTRLSGAAPAHSAADPWEKEHH RLSVRMGSHAHPLRRSRREAAFRSPYSSTEPLCSPSESDSDLEPVGAGIQ HLQ
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
FAM64A
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
FAM64A Protein (NBP2-14002PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for FAM64A Antibody

  • family with sequence similarity 64, member A
  • FLJ10156
  • FLJ10491
  • RCS1
  • regulator of chromosome segregation 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-12553
Species: Hu
AF1513
Species: Mu
Applications: WB, Simple Western, Flow, IHC, IP, CyTOF-ready
NB100-402
Species: Hu, Mu, Rt, Po, Xp, Ze
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
AF2898
Species: Mu
Applications: WB, IP
NBP1-32108
Species: Hu, Rt
Applications: WB, ICC/IF
AF1183
Species: Hu
Applications: WB, IHC, IP, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)
NBP2-45897
Species: Hu
Applications: WB, IHC
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NBP2-02105
Species: Hu, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-86658
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NB100-2628
Species: Hu, Mu
Applications: WB, ELISA, Flow, IHC, IP, CyTOF-ready
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
AF7560
Species: Hu, Mu, Rt
Applications: WB
AF5016
Species: Hu
Applications: WB
NBP1-30027
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB600-41532
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-06677
Species: Hu

Publications for FAM64A Antibody (NBP2-14002) (0)

There are no publications for FAM64A Antibody (NBP2-14002).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FAM64A Antibody (NBP2-14002) (0)

There are no reviews for FAM64A Antibody (NBP2-14002). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for FAM64A Antibody (NBP2-14002) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional FAM64A Products

Bioinformatics Tool for FAM64A Antibody (NBP2-14002)

Discover related pathways, diseases and genes to FAM64A Antibody (NBP2-14002). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for FAM64A Antibody (NBP2-14002)

Discover more about diseases related to FAM64A Antibody (NBP2-14002).
 

Pathways for FAM64A Antibody (NBP2-14002)

View related products by pathway.

Research Areas for FAM64A Antibody (NBP2-14002)

Find related products by research area.

Blogs on FAM64A

There are no specific blogs for FAM64A, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our FAM64A Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol FAM64A