FAM62A Antibody


Immunocytochemistry/ Immunofluorescence: FAM62A Antibody [NBP2-57412] - Staining of human cell line SiHa shows localization to endoplasmic reticulum.

Product Details

Reactivity HuSpecies Glossary
Applications ICC/IF

Order Details

FAM62A Antibody Summary

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: SSGPNSRLYMKLVMRILYLDSSEICFPTVPGCPGAWDVDSENPQRGSSVDAPPRPCHTTPDSQFGTEHVLRIHVLEAQDLIAKDRF
Specificity of human FAM62A antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
FAM62A Recombinant Protein Antigen (NBP2-57412PEP)

Reactivity Notes

Mouse 81%, Rat 81%

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Affinity purified

Alternate Names for FAM62A Antibody

  • E-Syt1
  • extended synaptotagmin-like protein 1
  • family with sequence similarity 62 (C2 domain containing), member A
  • KIAA0747FAM62A
  • MBC2extended synaptotagmin-1
  • Membrane-bound C2 domain-containing protein


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P, IF
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IP, AP
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu, Mu
Applications: WB, IB, IHC, IHC-Fr, IP
Species: Hu, Mu, Rt, Dr, I, Ma
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P, Dual ISH-IHC, IHC-FrFl, IHC-WhMt, KO
Species: Hu
Applications: Flow, CyTOF-ready, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
Species: Hu, Mu, Rt, Po, Bv, Ca, Ch, Eq, Ha, Pm, Pm, Rb
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
Species: Mu
Applications: WB, IHC
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for FAM62A Antibody (NBP2-57412) (0)

There are no publications for FAM62A Antibody (NBP2-57412).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FAM62A Antibody (NBP2-57412) (0)

There are no reviews for FAM62A Antibody (NBP2-57412). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for FAM62A Antibody (NBP2-57412) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Other Available Formats

Additional FAM62A Products

Bioinformatics Tool for FAM62A Antibody (NBP2-57412)

Discover related pathways, diseases and genes to FAM62A Antibody (NBP2-57412). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on FAM62A

There are no specific blogs for FAM62A, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our FAM62A Antibody and receive a gift card or discount.


Gene Symbol ESYT1