Factor XIIIa Antibody - BSA Free

Immunohistochemistry-Paraffin: Factor XIIIa Antibody [NBP1-83938] - Analysis in human placenta and liver tissues. Corresponding Factor XIIIa RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: Factor XIIIa Antibody [NBP1-83938] - Staining of human placenta shows strong cytoplasmic positivity in Hofbauer cells.

Immunohistochemistry-Paraffin: Factor XIIIa Antibody [NBP1-83938] - Staining of human fallopian tube shows no positivity in glandular cells as expected.

Immunohistochemistry-Paraffin: Factor XIIIa Antibody [NBP1-83938] - Staining of human liver shows no positivity in hepatocytes as expected.

Immunohistochemistry-Paraffin: Factor XIIIa Antibody [NBP1-83938] - Staining of human testis shows moderate cytoplasmic positivity in Leydig cells.

• Reactivity: Hu
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Factor XIIIa Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: LNVTSVHLFKERWDTNKVDHHTDKYENNKLIVRRGQSFYVQIDFSRPYDPRRDLFRVEYVIGRYPQENKGTYIPVPIVSELQSGKWGAKIVMREDRSVRLSIQSSPKCIVGKFRMYVAVWTPYGVLRTSRNPETDT
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: F13A1
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200-1:500
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  Factor XIIIa Protein (NBP1-83938PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (87%), Rat (87%).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for Factor XIIIa Antibody - BSA Free

• bA525O21.1 (coagulation factor XIII, A1 polypeptide)
• coagulation factor XIII A chain
• coagulation factor XIII, A1 polypeptide
• Coagulation factor XIIIa
• EC 2.3.2.13
• F13A
• F13A1
• F13Acoagulation factor XIII, A polypeptide
• factor XIIIa
• fibrin stabilizing factor, A subunit
• fibrinoligase
• FSF, A Subunit
• Protein-glutamine gamma-glutamyltransferase A chain
• TGase
• Transglutaminase A chain
• transglutaminase. plasma

Background

Factor XIII is a beta globulin found in plasma and is composed of two subunits. Coagulation factor XIII is the last zymogen to become activated in the blood coagulation cascade. Factor XIII A is the catalytic subunit and is a dimmer of molecular weight 160kDa. The B subunits do not have enzymatic activity and may serve as a plasma carrier molecules. Platelet factor XIII is comprised only of 2 A subunits, which are identical to those of plasma origin. Upon activation by the cleavage of the activation peptide by thrombin and in the presence of calcium ion, the plasma factor XIII dissociates its B subunits and yields the same active enzyme, factor XIII A, as platelet factor XIII. This enzyme acts as a transglutaminase to catalyze the formation of gamma-glutamyl-epsilon-lysine crosslinking between fibrin molecules, thus stabilizing the fibrin clot. It also crosslinks alpha-2-plasmin inhibitor, or fibronectin, to the alpha chains of fibrin. Factor XIII deficiency is classified into two categories: type I deficiency, characterized by the lack of both the A and B subunits; and type II deficiency, characterized by the lack of the A subunit alone. These defects can result in a lifelong bleeding tendency, defective wound healing, and habitual abortion. Factor XIII A is a dermal dendrocyte marker and shows variable reaction with these types of tumors. It can be used for histiocytic phenotyping and has been reported to mark capillary hemangiomas and tumors of the central nervous system.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Factor XIIIa Antibody (NBP1-83938)(2)

Publications using NBP1-83938

• Azimi A, Pernemalm M, Frostvik Stolt M et al. Proteomics analysis of melanoma metastases: association between S100A13 expression and chemotherapy resistance. Br J Cancer 2014-05-13 [PMID: 24722184] (IF/IHC)
• Kato BS, Nicholson G, Neiman M et al. Variance decomposition of protein profiles from antibody arrays using a longitudinal twin model. Proteome Sci 2011-11-17 [PMID: 22093360]

Bioinformatics

• Gene Symbol: F13A1