Factor XIIIa Antibody

Images

 
Immunohistochemistry-Paraffin: Factor XIIIa Antibody [NBP1-83938] - Staining of human corpus, uterine, shows strong cytoplasmic positivity in a subset of cells in endometrial stroma.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Factor XIIIa Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:LNVTSVHLFKERWDTNKVDHHTDKYENNKLIVRRGQSFYVQIDFSRPYDPRRDLFRVEYVIGRYPQENKGTYIPVPIVSELQSGKWGAKIVMREDRSVRLSIQSSPKCIVGKFRMYVAVWTPYGVLRTSRNPETDT
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
F13A1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Factor XIIIa Protein (NBP1-83938PEP)
Publications
Read Publications using NBP1-83938.

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (87%), Rat (87%). Reactivity reported in scientific literature (PMID: 22093360)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Factor XIIIa Antibody

  • bA525O21.1 (coagulation factor XIII, A1 polypeptide)
  • coagulation factor XIII A chain
  • coagulation factor XIII, A1 polypeptide
  • Coagulation factor XIIIa
  • EC 2.3.2.13
  • F13Acoagulation factor XIII, A polypeptide
  • factor XIIIa
  • fibrin stabilizing factor, A subunit
  • fibrinoligase
  • FSF, A subunit
  • Protein-glutamine gamma-glutamyltransferase A chain
  • TGase
  • Transglutaminase A chain
  • transglutaminase. plasma

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB600-1071
Species: Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP2-24470
Species: Hu
Applications: WB, Simple Western, IHC-P
NB100-683
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NB300-223
Species: Hu, Mu, Rt, Ca
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-91258
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
H00003117-M01
Species: Hu
Applications: WB, ELISA, PLA
NB120-15200
Species: Hu, Mu, Sh
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NB600-930
Species: Hu, Ba
Applications: WB, ELISA
NBP2-45224
Species: Hu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-29403
Species: Hu, Mu, Rt, Bv
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NB120-22711
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NB600-586
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-81838
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NB100-1642
Species: Mu
Applications: Flow, ICC/IF, IHC, IHC-Fr, IP, Flow-CS
NBP1-84856
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-91761
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-20648
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, IHC-P

Publications for Factor XIIIa Antibody (NBP1-83938)(2)

Reviews for Factor XIIIa Antibody (NBP1-83938) (0)

There are no reviews for Factor XIIIa Antibody (NBP1-83938). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for Factor XIIIa Antibody (NBP1-83938) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Factor XIIIa Products

Bioinformatics Tool for Factor XIIIa Antibody (NBP1-83938)

Discover related pathways, diseases and genes to Factor XIIIa Antibody (NBP1-83938). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Factor XIIIa Antibody (NBP1-83938)

Discover more about diseases related to Factor XIIIa Antibody (NBP1-83938).
 

Pathways for Factor XIIIa Antibody (NBP1-83938)

View related products by pathway.

PTMs for Factor XIIIa Antibody (NBP1-83938)

Learn more about PTMs related to Factor XIIIa Antibody (NBP1-83938).
 

Research Areas for Factor XIIIa Antibody (NBP1-83938)

Find related products by research area.

Blogs on Factor XIIIa

There are no specific blogs for Factor XIIIa, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Factor XIIIa Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol F13A1