Orthogonal Strategies: Immunohistochemistry-Paraffin: Factor XIIIa Antibody [NBP1-83938] - Analysis in human placenta and liver tissues. Corresponding Factor XIIIa RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: Factor XIIIa Antibody [NBP1-83938] - Staining of human placenta shows strong cytoplasmic positivity in Hofbauer cells.
Immunohistochemistry-Paraffin: Factor XIIIa Antibody [NBP1-83938] - Staining of human fallopian tube shows no positivity in glandular cells as expected.
Immunohistochemistry-Paraffin: Factor XIIIa Antibody [NBP1-83938] - Staining of human liver shows no positivity in hepatocytes as expected.
Immunohistochemistry-Paraffin: Factor XIIIa Antibody [NBP1-83938] - Staining of human testis shows moderate cytoplasmic positivity in Leydig cells.
Novus Biologicals Rabbit Factor XIIIa Antibody - BSA Free (NBP1-83938) is a polyclonal antibody validated for use in IHC. Anti-Factor XIIIa Antibody: Cited in 2 publications. All Novus Biologicals antibodies are covered by our 100% guarantee.
Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: LNVTSVHLFKERWDTNKVDHHTDKYENNKLIVRRGQSFYVQIDFSRPYDPRRDLFRVEYVIGRYPQENKGTYIPVPIVSELQSGKWGAKIVMREDRSVRLSIQSSPKCIVGKFRMYVAVWTPYGVLRTSRNPETDT
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
F13A1
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Protein-glutamine gamma-glutamyltransferase A chain
TGase
Transglutaminase A chain
transglutaminase. plasma
Background
Factor XIII is a beta globulin found in plasma and is composed of two subunits. Coagulation factor XIII is the last zymogen to become activated in the blood coagulation cascade. Factor XIII A is the catalytic subunit and is a dimmer of molecular weight 160kDa. The B subunits do not have enzymatic activity and may serve as a plasma carrier molecules. Platelet factor XIII is comprised only of 2 A subunits, which are identical to those of plasma origin. Upon activation by the cleavage of the activation peptide by thrombin and in the presence of calcium ion, the plasma factor XIII dissociates its B subunits and yields the same active enzyme, factor XIII A, as platelet factor XIII. This enzyme acts as a transglutaminase to catalyze the formation of gamma-glutamyl-epsilon-lysine crosslinking between fibrin molecules, thus stabilizing the fibrin clot. It also crosslinks alpha-2-plasmin inhibitor, or fibronectin, to the alpha chains of fibrin. Factor XIII deficiency is classified into two categories: type I deficiency, characterized by the lack of both the A and B subunits; and type II deficiency, characterized by the lack of the A subunit alone. These defects can result in a lifelong bleeding tendency, defective wound healing, and habitual abortion. Factor XIII A is a dermal dendrocyte marker and shows variable reaction with these types of tumors. It can be used for histiocytic phenotyping and has been reported to mark capillary hemangiomas and tumors of the central nervous system.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
=
÷
Review this Product
Be the first to review our Factor XIIIa Antibody - BSA Free and receive a gift card or discount.