F-Spondin/SPON1 Antibody - BSA Free

Western blot shows lysates of OVCAR3 and F-Spondin/SPON1 knockout OVCAR3 cell line (KO). Nitrocellulose membrane was probed with F-Spondin/SPON1 Antibody (Catalog # NBP2-69044) O/N at 4C, followed by HRP-conjugated Secondary Antibody and ECL detection. A specific band was detected for F-Spondin/SPON1 (as indicated) in the parental OVCAR3 cell line, but is not detectable in knockout OVCAR3 cell line. Antibody dilution used: 1/500. The Ponceau stained transfers of each blot are shown. Image, protocol and testing courtesy of YCharOS Inc. (ycharos.com).

Immunohistochemistry-Paraffin: F-Spondin/SPON1 Antibody [NBP2-69044] - Staining of human small intestine shows positivity in glandular cells, smooth muscle and plasma.

• Reactivity: Hu, Mu, Rt
• Applications: WB, IHC, KO
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

F-Spondin/SPON1 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: SLTKKLCEQDSTFDGVTDKPILDCCACGTAKYRLTFYGNWSEKTHPKDYPRRANHWSAIIGGSHSKNYVLWEYGGYASEGVKQVAELGSPV
• Predicted Species: Mouse (97%), Rat (97%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SPON1
• Purity: Protein A purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Knockout Validated Application from YCharOS.
  • Western Blot Application from YCharOS.
• Application Notes: Recommended conditions for IHC,Retrieval method: HIER pH6
• Control Peptide:

  F-Spondin/SPON1 Recombinant Protein Antigen (NBP2-69044PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Protein A purified

Alternate Names for F-Spondin/SPON1 Antibody - BSA Free

• FSpondin
• F-Spondin
• KIAA0762VSGP/F-spondin
• MGC10724
• SPON1
• spondin 1, (f-spondin) extracellular matrix protein
• spondin 1, extracellular matrix protein
• spondin-1
• Vascular smooth muscle cell growth-promoting factor
• VSGP

Background

SPON1 is a member of a subgroup of the thrombospondin type 1 (TSR) class molecules, defined by two domains of homology, the FS1/FS2 and TSR domains. The TSRs of SPON1 proteins are typical of class 2 TSRs. SPON1, which is similar to thrombospondin, is a extracellular matrix attached molecule that promotes neurite outgrowth and inhibits angiogenesis. Analysis of gain and loss of function experiments reveal that SPON1 is required for accurate pathfinding of embryonic axons, and plays a dual role in patterning axonal trajectories. It promotes the outgrowth of commissural and inhibits the outgrowth of motor axons, and has also been implicated in inflammatory processes in the nervous system.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: SPON1