EVPL Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: EVPL Antibody [NBP2-37940] - Immunofluorescent staining of human cell line MCF7 shows localization to intermediate filaments.
Immunohistochemistry-Paraffin: EVPL Antibody [NBP2-37940] - Staining in human skin and skeletal muscle tissues using anti-EVPL antibody. Corresponding EVPL RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: EVPL Antibody [NBP2-37940] - Staining of human breast shows moderate membranous and cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: EVPL Antibody [NBP2-37940] - Staining of human skeletal muscle shows low expression as expected.
Immunohistochemistry-Paraffin: EVPL Antibody [NBP2-37940] - Staining of human skin shows high expression.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

EVPL Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: DVGPRVDWARVLEQKQKQVCAGQYGPGMAELEQQIAEHNILQKEIDAYGQQLRSLVGPDAATIRSQYRDLLKAASWRGQSLGSLYTHLQ
Specificity
Specificity of human EVPL antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
EVPL
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
EVPL Protein (NBP2-37940PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (85%), Rat (85%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for EVPL Antibody

  • 210 KDa Cornified Envelope Precursor Protein
  • 210 KDa Paraneoplastic Pemphigus Antigen
  • envoplakin
  • EVPK
  • p210

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF5414
Species: Hu
Applications: WB, Simple Western
NBP1-19097
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, PLA
NBP1-18783
Species: Hu, Mu
Applications: WB, IHC, IHC-P
AF7548
Species: Hu
Applications: IHC
NBP2-49306
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-49879
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
DDX0450P-100
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-Fr
NBP1-78984
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP, ICC
NB600-1071
Species: Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
AF944
Species: Hu
Applications: WB, IHC
NB100-56104
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-Fr, IHC-P, IP
AF887
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
NBP1-84020
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-56708
Species: Hu, Mu, Rt, Po, ChHa, Ma
Applications: WB, Simple Western, EM, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready, KO
NBP1-18891
Species: Hu, Mu
Applications: WB, IP
AF2168
Species: Hu, Mu
Applications: WB, Simple Western, ChIP
NB600-335
Species: Hu, Mu, Ec, NA
Applications: WB, ELISA, ICC/IF, IHC-Fr, IP

Publications for EVPL Antibody (NBP2-37940) (0)

There are no publications for EVPL Antibody (NBP2-37940).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for EVPL Antibody (NBP2-37940) (0)

There are no reviews for EVPL Antibody (NBP2-37940). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for EVPL Antibody (NBP2-37940) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional EVPL Products

EVPL NBP2-37940

Bioinformatics Tool for EVPL Antibody (NBP2-37940)

Discover related pathways, diseases and genes to EVPL Antibody (NBP2-37940). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for EVPL Antibody (NBP2-37940)

Discover more about diseases related to EVPL Antibody (NBP2-37940).
 

Pathways for EVPL Antibody (NBP2-37940)

View related products by pathway.

Blogs on EVPL

There are no specific blogs for EVPL, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our EVPL Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol EVPL
Uniprot