EVPL Antibody - BSA Free

Immunohistochemistry-Paraffin: EVPL Antibody [NBP2-37940] - Staining in human skin and skeletal muscle tissues using anti-EVPL antibody. Corresponding EVPL RNA-seq data are presented for the same tissues.

Immunocytochemistry/Immunofluorescence: EVPL Antibody [NBP2-37940] - Staining of human cell line MCF7 shows localization to intermediate filaments. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: EVPL Antibody [NBP2-37940] - Staining of human skeletal muscle shows low expression as expected.

Immunohistochemistry-Paraffin: EVPL Antibody [NBP2-37940] - Staining of human skin shows high expression.

• Reactivity: Hu
• Applications: ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

EVPL Antibody - BSA Free Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: DVGPRVDWARVLEQKQKQVCAGQYGPGMAELEQQIAEHNILQKEIDAYGQQLRSLVGPDAATIRSQYRDLLKAASWRGQSLGSLYTHLQ
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: EVPL
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  EVPL Protein (NBP2-37940PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (85%), Rat (85%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for EVPL Antibody - BSA Free

• 210 KDa Cornified Envelope Precursor Protein
• 210 KDa Paraneoplastic Pemphigus Antigen
• envoplakin
• EVPK
• p210

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for EVPL Antibody (NBP2-37940)(1)

Publication using NBP2-37940

• Srivastava A, Tommasi C, Sessions D et al. MAB21L4 deficiency drives squamous cell carcinoma via activation of RET Cancer research 2022-06-15 [PMID: 35705526] (PLA, Human)

Bioinformatics

• Gene Symbol: EVPL
• Uniprot:
  • Q92817(Human)